PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSVIVT01025502001

Organism

Vitis vinifera

Taxonomic ID

29760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis

Family

G2-like

Protein Properties

Length: 164aa MW: 18554.2 Da PI: 10.7017

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSVIVT01025502001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	103.1	1.8e-32	21	75	1	55
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 kprl+WtpeLHerF+eav+qLGG+ kAtPkti++ m+++g+tl+h+kSHLQkYR+ GSVIVT01025502001 21 KPRLKWTPELHERFMEAVNQLGGAYKATPKTIMKQMGIQGITLNHIKSHLQKYRM 75 79****************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	11.176	18	78	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	2.2E-29	19	76	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.08E-17	20	75	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	6.7E-24	21	75	IPR006447	Myb domain, plants
Pfam	PF00249	9.6E-12	23	74	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 164 aa Download sequence Send to blast
MNQNRRHNQG NTGPVLLADS KPRLKWTPEL HERFMEAVNQ LGGAYKATPK TIMKQMGIQG 60 ITLNHIKSHL QKYRMSEHFL GQASTENTRN DGIAAVTGDR RFEANGESIY KIPLGSHTNK 120 SLQKSTALQM LIEVPRRPHE QLEVLHNFNS RFLTSLIFTI SHI*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6j4k_A	6e-21	21	78	2	59	Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B	6e-21	21	78	2	59	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A	5e-21	21	78	1	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B	5e-21	21	78	1	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C	5e-21	21	78	1	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D	5e-21	21	78	1	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A	6e-21	21	78	2	59	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C	6e-21	21	78	2	59	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D	6e-21	21	78	2	59	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F	6e-21	21	78	2	59	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H	6e-21	21	78	2	59	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J	6e-21	21	78	2	59	Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in phloem and/or cambium. {ECO:0000269\|PubMed:15923329}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269\|PubMed:21255164, ECO:0000305\|PubMed:15592750}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269\|PubMed:15592750}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM461935	3e-69	AM461935.2 Vitis vinifera contig VV78X257019.3, whole genome shotgun sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010651406.1	5e-96	PREDICTED: myb-related protein 2 isoform X3
Swissprot	Q9SQQ9	1e-40	PHL9_ARATH; Myb-related protein 2
TrEMBL	A0A438EM75	1e-90	A0A438EM75_VITVI; Myb-related protein 2
TrEMBL	A0A438JVP8	9e-91	A0A438JVP8_VITVI; Myb-related protein 2
STRING	VIT_06s0004g00150.t01	5e-52	(Vitis vinifera)
STRING	XP_010257717.1	2e-49	(Nelumbo nucifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP78	17	262

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G04030.1	2e-43	G2-like family protein

Link Out ? help Back to Top
Phytozome	GSVIVT01025502001

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Nakano Y,Naito Y,Nakano T,Ohtsuki N,Suzuki K NSR1/MYR2 is a negative regulator of ASN1 expression and its possible involvement in regulation of nitrogen reutilization in Arabidopsis. Plant Sci., 2017. 263: p. 219-225 [PMID:28818378]