![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSVIVT01025648001 | ||||||||
| Common Name | LOC100241470, VIT_08s0040g02220 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 90aa MW: 10132.1 Da PI: 10.2814 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 124.8 | 2.8e-39 | 22 | 89 | 3 | 70 |
S1FA 3 vakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
v+ +eakG+nPGlivll+v g+llvflvgn++ly+yaqk+lP kkkPvskkk+kre+lkqGv++PGe
GSVIVT01025648001 22 VKDAEAKGFNPGLIVLLLVVGVLLVFLVGNFLLYMYAQKTLPRMKKKPVSKKKMKRERLKQGVSAPGE 89
6789***************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04689 | 3.1E-38 | 25 | 89 | IPR006779 | DNA binding protein S1FA |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 90 aa Download sequence Send to blast |
MDDEFEFAEK VPPSFDRMEN MVKDAEAKGF NPGLIVLLLV VGVLLVFLVG NFLLYMYAQK 60 TLPRMKKKPV SKKKMKRERL KQGVSAPGE* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Vvi.12940 | 1e-149 | flower| fruit| inflorescence| stem | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM454172 | 1e-118 | AM454172.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X099447.7, clone ENTAV 115. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002279933.1 | 2e-57 | PREDICTED: DNA-binding protein S1FA | ||||
| Swissprot | P42553 | 3e-16 | S1FA1_ORYSJ; DNA-binding protein S1FA1 | ||||
| TrEMBL | A0A438IPU2 | 4e-56 | A0A438IPU2_VITVI; DNA-binding protein S1FA1 | ||||
| TrEMBL | D7TQI4 | 4e-56 | D7TQI4_VITVI; Uncharacterized protein | ||||
| STRING | VIT_08s0040g02220.t01 | 6e-57 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP5095 | 13 | 22 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GSVIVT01025648001 |
| Entrez Gene | 100241470 |




