PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSVIVT01031730001

Common Name

VITISV_001773

Organism

Vitis vinifera

Taxonomic ID

29760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis

Family

bZIP

Protein Properties

Length: 73aa MW: 8470.84 Da PI: 10.8003

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSVIVT01031730001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	44.8	2.8e-14	1	40	10	49
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 ++kNRe+A rsR+RK+a++ eLe +v++L++ N++L+k+ GSVIVT01031730001 1 MIKNRESAARSRARKQAYTLELEMEVAKLKEANEELQKKQ 40 68*******************************9999864 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF57959	3.81E-10	1	50	No hit	No description
PROSITE profile	PS50217	9.473	1	57	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	4.9E-13	1	50	No hit	No description
SMART	SM00338	5.9E-5	1	56	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	1.2E-11	1	44	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009738	Biological Process	abscisic acid-activated signaling pathway
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 73 aa Download sequence Send to blast
MIKNRESAAR SRARKQAYTL ELEMEVAKLK EANEELQKKQ ADMEVQKNQI LETIRQRGGK 60 RLCLRRTLTG PW*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in roots and flowers. {ECO:0000269\|PubMed:11884679}.

Functional Description ? help Back to Top
Source	Description
UniProt	Binds to the ABA-responsive element (ABRE). Mediates stress-responsive ABA signaling. {ECO:0000269\|PubMed:11884679, ECO:0000269\|PubMed:15361142}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by drought, salt, abscisic acid (ABA). {ECO:0000269\|PubMed:10636868, ECO:0000269\|PubMed:16284313}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	FQ392967	1e-119	FQ392967.1 Vitis vinifera clone SS0AFA3YF08.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003631613.1	7e-43	PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform X1
Refseq	XP_010647746.1	7e-43	PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform X1
Refseq	XP_010647747.1	7e-43	PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform X2
Refseq	XP_019074525.1	7e-43	PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform X1
Swissprot	Q9M7Q3	2e-28	AI5L6_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 6
TrEMBL	A0A438EPP4	2e-41	A0A438EPP4_VITVI; Abscisic acid-insensitive 5-like protein 6
TrEMBL	A5AX01	2e-41	A5AX01_VITVI; Uncharacterized protein
TrEMBL	F6HQA3	1e-41	F6HQA3_VITVI; Uncharacterized protein
STRING	VIT_03s0063g00310.t01	2e-42	(Vitis vinifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP540	15	80

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G34000.2	7e-31	abscisic acid responsive elements-binding factor 3

Link Out ? help Back to Top
Phytozome	GSVIVT01031730001

Publications ? help Back to Top
Zhao Q, et al. Regulation and function of Arabidopsis AtGALK2 gene in abscisic acid response signaling. Mol. Biol. Rep., 2018. [PMID:24078097] Bao Y, et al. The tumor necrosis factor receptor-associated factor (TRAF)-like family protein SEVEN IN ABSENTIA 2 (SINA2) promotes drought tolerance in an ABA-dependent manner in Arabidopsis. New Phytol., 2014. 202(1): p. 174-87 [PMID:24350984] González-Grandío E,Cubas P Identification of gene functions associated to active and dormant buds in Arabidopsis. Plant Signal Behav, 2014. 9(2): p. e27994 [PMID:24518068] Xie M, et al. AtWNK9 is regulated by ABA and dehydration and is involved in drought tolerance in Arabidopsis. Plant Physiol. Biochem., 2014. 77: p. 73-83 [PMID:24561249] Kim EY,Seo YS,Park KY,Kim SJ,Kim WT Overexpression of CaDSR6 increases tolerance to drought and salt stresses in transgenic Arabidopsis plants. Gene, 2014. 552(1): p. 146-54 [PMID:25234727] Zhang H, et al. The RING finger ubiquitin E3 ligase SDIR1 targets SDIR1-INTERACTING PROTEIN1 for degradation to modulate the salt stress response and ABA signaling in Arabidopsis. Plant Cell, 2015. 27(1): p. 214-27 [PMID:25616872] Baek D, et al. A Role for Arabidopsis miR399f in Salt, Drought, and ABA Signaling. Mol. Cells, 2016. 39(2): p. 111-8 [PMID:26674968] Bao Y, et al. Overexpression of the NDR1/HIN1-Like Gene NHL6 Modifies Seed Germination in Response to Abscisic Acid and Abiotic Stresses in Arabidopsis. PLoS ONE, 2016. 11(2): p. e0148572 [PMID:26849212] Gao S, et al. ABF2, ABF3, and ABF4 Promote ABA-Mediated Chlorophyll Degradation and Leaf Senescence by Transcriptional Activation of Chlorophyll Catabolic Genes and Senescence-Associated Genes in Arabidopsis. Mol Plant, 2016. 9(9): p. 1272-1285 [PMID:27373216] Li X, et al. Dual Function of NAC072 in ABF3-Mediated ABA-Responsive Gene Regulation in Arabidopsis. Front Plant Sci, 2016. 7: p. 1075 [PMID:27486475] Wang Z, et al. Overexpressing Arabidopsis ABF3 increases tolerance to multiple abiotic stresses and reduces leaf size in alfalfa. Plant Physiol. Biochem., 2016. 109: p. 199-208 [PMID:27721135] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Kerr TCC, et al. Ectopic expression of two AREB/ABF orthologs increases drought tolerance in cotton (Gossypium hirsutum). Plant Cell Environ., 2018. 41(5): p. 898-907 [PMID:28098349] Lyzenga WJ,Sullivan V,Liu H,Stone SL The Kinase Activity of Calcineurin B-like Interacting Protein Kinase 26 (CIPK26) Influences Its Own Stability and that of the ABA-regulated Ubiquitin Ligase, Keep on Going (KEG). Front Plant Sci, 2017. 8: p. 502 [PMID:28443108] Song C,Kim T,Chung WS,Lim CO The Arabidopsis Phytocystatin AtCYS5 Enhances Seed Germination and Seedling Growth under Heat Stress Conditions. Mol. Cells, 2017. 40(8): p. 577-586 [PMID:28756655] Fernando VCD,Al Khateeb W,Belmonte MF,Schroeder DF Role of Arabidopsis ABF1/3/4 during det1 germination in salt and osmotic stress conditions. Plant Mol. Biol., 2018. 97(1-2): p. 149-163 [PMID:29680877] Kim HJ, et al. Confirmation of Drought Tolerance of Ectopically Expressed AtABF3 Gene in Soybean. Mol. Cells, 2018. 41(5): p. 413-422 [PMID:29754472]