PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01033216001
Common NameVIT_04s0069g01150
Organism
Vitis vinifera
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family bZIP
Protein Properties Length: 58aa    MW: 7189.3 Da    PI: 11.129
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01033216001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.87.4e-16851548
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48
                       +r++r++kN e+A+rsR+RK+a++ eLe+kv  Le+eN++L+k+
  GSVIVT01033216001  8 RRQKRMIKNWESATRSRARKQAYTNELENKVSRLEEENERLRKR 51
                       69****************************************86 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.5E-5455IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.864651IPR004827Basic-leucine zipper domain
PfamPF001701.3E-13851IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.9E-14851No hitNo description
SuperFamilySSF579592.63E-11851No hitNo description
PROSITE patternPS0003601126IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 58 aa     Download sequence    Send to blast
MIEKTIERRQ KRMIKNWESA TRSRARKQAY TNELENKVSR LEEENERLRK RKVYIFF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.246902e-77cell culture| flower| fruit
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in embryo during the latest stages of seed maturation. {ECO:0000269|PubMed:15642716}.
UniprotTISSUE SPECIFICITY: Predominantly expressed in seeds. {ECO:0000269|PubMed:12376636}.
Functional Description ? help Back to Top
Source Description
UniProtBinds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter and to the ABRE of the Em1 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4265552e-43AM426555.2 Vitis vinifera contig VV78X160260.4, whole genome shotgun sequence.
GenBankAM4354752e-43AM435475.1 Vitis vinifera contig VV78X054728.11, whole genome shotgun sequence.
GenBankKJ0093922e-43KJ009392.1 Paeonia ostii basic region/leucine zipper motif transcription factor (bZIP) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006585689.16e-24ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X2
RefseqXP_018842402.17e-24PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_023879338.16e-24ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_028244783.16e-24ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X3
SwissprotQ9C5Q28e-20AI5L3_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 3
TrEMBLD7T0G06e-31D7T0G0_VITVI; Uncharacterized protein
STRINGVIT_04s0069g01150.t011e-31(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP10063711
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.14e-14ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Haas BJ, et al.
    Full-length messenger RNA sequences greatly improve genome annotation.
    Genome Biol., 2002. 3(6): p. RESEARCH0029
    [PMID:12093376]
  2. Sakuraba Y,Han SH,Lee SH,Hörtensteiner S,Paek NC
    Arabidopsis NAC016 promotes chlorophyll breakdown by directly upregulating STAYGREEN1 transcription.
    Plant Cell Rep., 2016. 35(1): p. 155-66
    [PMID:26441053]
  3. Kim H, et al.
    ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis.
    Plant Mol. Biol., 2016. 90(3): p. 303-15
    [PMID:26667153]