![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSVIVT01033216001 | ||||||||
| Common Name | VIT_04s0069g01150 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 58aa MW: 7189.3 Da PI: 11.129 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 49.8 | 7.4e-16 | 8 | 51 | 5 | 48 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48
+r++r++kN e+A+rsR+RK+a++ eLe+kv Le+eN++L+k+
GSVIVT01033216001 8 RRQKRMIKNWESATRSRARKQAYTNELENKVSRLEEENERLRKR 51
69****************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 3.5E-5 | 4 | 55 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 10.864 | 6 | 51 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 1.3E-13 | 8 | 51 | IPR004827 | Basic-leucine zipper domain |
| Gene3D | G3DSA:1.20.5.170 | 4.9E-14 | 8 | 51 | No hit | No description |
| SuperFamily | SSF57959 | 2.63E-11 | 8 | 51 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 11 | 26 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 58 aa Download sequence Send to blast |
MIEKTIERRQ KRMIKNWESA TRSRARKQAY TNELENKVSR LEEENERLRK RKVYIFF* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Vvi.24690 | 2e-77 | cell culture| flower| fruit | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed in embryo during the latest stages of seed maturation. {ECO:0000269|PubMed:15642716}. | |||||
| Uniprot | TISSUE SPECIFICITY: Predominantly expressed in seeds. {ECO:0000269|PubMed:12376636}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter and to the ABRE of the Em1 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM426555 | 2e-43 | AM426555.2 Vitis vinifera contig VV78X160260.4, whole genome shotgun sequence. | |||
| GenBank | AM435475 | 2e-43 | AM435475.1 Vitis vinifera contig VV78X054728.11, whole genome shotgun sequence. | |||
| GenBank | KJ009392 | 2e-43 | KJ009392.1 Paeonia ostii basic region/leucine zipper motif transcription factor (bZIP) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006585689.1 | 6e-24 | ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X2 | ||||
| Refseq | XP_018842402.1 | 7e-24 | PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
| Refseq | XP_023879338.1 | 6e-24 | ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
| Refseq | XP_028244783.1 | 6e-24 | ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X3 | ||||
| Swissprot | Q9C5Q2 | 8e-20 | AI5L3_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 3 | ||||
| TrEMBL | D7T0G0 | 6e-31 | D7T0G0_VITVI; Uncharacterized protein | ||||
| STRING | VIT_04s0069g01150.t01 | 1e-31 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP10063 | 7 | 11 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G56850.1 | 4e-14 | ABA-responsive element binding protein 3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GSVIVT01033216001 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




