![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSVIVT01035426001 | ||||||||
| Common Name | LOC100266400, VIT_04s0008g01470 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 167aa MW: 18916.7 Da PI: 4.9949 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 100.3 | 1.1e-31 | 103 | 161 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDg++WrKYG+K+vk+s++pr+YYrC+ gC+vkk+ver++edpk+v++tYeg Hnhe
GSVIVT01035426001 103 LDDGFKWRKYGKKMVKNSPNPRNYYRCSVDGCNVKKRVERDREDPKYVITTYEGIHNHE 161
59********************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 4.4E-34 | 89 | 163 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 9.02E-29 | 95 | 163 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 32.041 | 98 | 163 | IPR003657 | WRKY domain |
| SMART | SM00774 | 1.1E-36 | 103 | 162 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.8E-24 | 104 | 161 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
| GO:0050832 | Biological Process | defense response to fungus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 167 aa Download sequence Send to blast |
MADTTAGSQD SPEAESDFEL GDTSNFELSE YLLFDDLMEE DHSAFLASEF AQNPIHPGNE 60 VDKPGSSSSQ HERPASRNSE SGQKKKEAKE RVAFITKSEI EILDDGFKWR KYGKKMVKNS 120 PNPRNYYRCS VDGCNVKKRV ERDREDPKYV ITTYEGIHNH ESPSKF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 4e-28 | 96 | 164 | 10 | 78 | Probable WRKY transcription factor 4 |
| 2lex_A | 4e-28 | 96 | 164 | 10 | 78 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Vvi.7775 | 0.0 | fruit| inflorescence| leaf | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00531 | DAP | Transfer from AT5G26170 | Download |
| |||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM431949 | 1e-125 | AM431949.2 Vitis vinifera contig VV78X111726.11, whole genome shotgun sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002279407.1 | 1e-122 | PREDICTED: probable WRKY transcription factor 50 | ||||
| Swissprot | Q8VWQ5 | 1e-42 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
| TrEMBL | D7STT5 | 1e-121 | D7STT5_VITVI; Uncharacterized protein | ||||
| STRING | VIT_04s0008g01470.t01 | 1e-121 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP14 | 17 | 875 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G26170.1 | 4e-45 | WRKY DNA-binding protein 50 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GSVIVT01035426001 |
| Entrez Gene | 100266400 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




