![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSVIVT01035614001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 197aa MW: 22734.3 Da PI: 10.8482 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 56.3 | 4.3e-18 | 75 | 109 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C +C t kTp+WR gp g+ktLCnaCG++y++ +l
GSVIVT01035614001 75 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 109
99*****************************9885 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00401 | 2.5E-16 | 69 | 119 | IPR000679 | Zinc finger, GATA-type |
| PROSITE profile | PS50114 | 12.334 | 69 | 105 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 2.0E-15 | 72 | 133 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 1.5E-14 | 73 | 107 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 7.90E-13 | 74 | 121 | No hit | No description |
| PROSITE pattern | PS00344 | 0 | 75 | 100 | IPR000679 | Zinc finger, GATA-type |
| Pfam | PF00320 | 5.5E-16 | 75 | 109 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0030154 | Biological Process | cell differentiation | ||||
| GO:0045944 | Biological Process | positive regulation of transcription from RNA polymerase II promoter | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0005667 | Cellular Component | transcription factor complex | ||||
| GO:0000977 | Molecular Function | RNA polymerase II regulatory region sequence-specific DNA binding | ||||
| GO:0001085 | Molecular Function | RNA polymerase II transcription factor binding | ||||
| GO:0001228 | Molecular Function | transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding | ||||
| GO:0003682 | Molecular Function | chromatin binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 197 aa Download sequence Send to blast |
MLISLATYAC RMMIWLSSNG SRTSLRNHSR ARTWKSFTSA HEPCHASGRR AFSRFPLQKE 60 SPEVVAGGCS DGRKCLHCAT DKTPQWRTGP MGPKTLCNAC GVRYKSGRLV PEYRPAASPT 120 FVLTKHSNSH RKVLELRRQK EMVRSQHQHQ QQQFLHHQNM VFDFLLCLIW QVLKPIFHNF 180 SNFFIFSSYH VLHMNF* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Vvi.15288 | 1e-169 | inflorescence | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in the vascular cylinder of roots. Expressed in the differentiation zone of the root stele. {ECO:0000269|PubMed:25265867}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). Transcription activator involved in xylem formation. Functions upstream of NAC030/VND7, a master switch of xylem vessel differentiation (PubMed:25265867). {ECO:0000250|UniProtKB:Q8LAU9, ECO:0000269|PubMed:25265867}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM454587 | 1e-176 | AM454587.2 Vitis vinifera contig VV78X034322.8, whole genome shotgun sequence. | |||
| GenBank | FQ380764 | 1e-176 | FQ380764.1 Vitis vinifera clone SS0ACG33YH16. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002283745.1 | 4e-63 | PREDICTED: GATA transcription factor 9 | ||||
| Swissprot | P69781 | 1e-46 | GAT12_ARATH; GATA transcription factor 12 | ||||
| TrEMBL | A0A438K893 | 9e-62 | A0A438K893_VITVI; GATA transcription factor | ||||
| TrEMBL | A5BCJ0 | 9e-62 | A5BCJ0_VITVI; GATA transcription factor | ||||
| STRING | VIT_04s0008g03270.t01 | 2e-62 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP68 | 17 | 287 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G25830.1 | 1e-48 | GATA transcription factor 12 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GSVIVT01035614001 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




