![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSVIVT01036760001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 115aa MW: 13151.8 Da PI: 4.8367 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 43.3 | 7.9e-14 | 1 | 35 | 4 | 35 |
NF-YC 4 sfwekq...iekatdfknhelPlarikkilkaded 35
+fw++q ie++tdfknh+lPlarikki+kaded
GSVIVT01036760001 1 MFWSNQmqeIEQTTDFKNHSLPLARIKKIMKADED 35
69**9988889***********************9 PP
| |||||||
| 2 | NF-YC | 42.6 | 1.3e-13 | 34 | 69 | 67 | 102 |
NF-YC 67 eenkrrtlkksdiaaavtrtdifdflvdivprdelk 102
e+nkrrtl+k+diaaa++rtd+fdflvdi+prdelk
GSVIVT01036760001 34 EDNKRRTLQKNDIAAAISRTDVFDFLVDIIPRDELK 69
589******************************975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 5.91E-13 | 7 | 59 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 2.3E-8 | 12 | 34 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 6.7E-10 | 35 | 65 | IPR009072 | Histone-fold |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0005737 | Cellular Component | cytoplasm | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 115 aa Download sequence Send to blast |
MFWSNQMQEI EQTTDFKNHS LPLARIKKIM KADEDNKRRT LQKNDIAAAI SRTDVFDFLV 60 DIIPRDELKE EGLGAVVDQS SIYAAQQPRP PVPFMPWPQA QSQPQQPQQQ QTDT* |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 37 | 43 | RRTLQKN |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Vvi.3085 | 1e-64 | bud| fruit| inflorescence| leaf | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:9662544}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM441941 | 3e-62 | AM441941.2 Vitis vinifera contig VV78X036116.11, whole genome shotgun sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002262881.2 | 1e-49 | PREDICTED: nuclear transcription factor Y subunit C-2 | ||||
| Refseq | XP_010645116.1 | 1e-49 | PREDICTED: nuclear transcription factor Y subunit C-2 | ||||
| Refseq | XP_010645117.1 | 1e-49 | PREDICTED: nuclear transcription factor Y subunit C-2 | ||||
| Refseq | XP_010645118.1 | 1e-49 | PREDICTED: nuclear transcription factor Y subunit C-2 | ||||
| Refseq | XP_010645119.1 | 1e-49 | PREDICTED: nuclear transcription factor Y subunit C-2 | ||||
| Refseq | XP_010645120.1 | 1e-49 | PREDICTED: nuclear transcription factor Y subunit C-2 | ||||
| Refseq | XP_010645121.1 | 1e-49 | PREDICTED: nuclear transcription factor Y subunit C-2 | ||||
| Refseq | XP_010645122.1 | 1e-49 | PREDICTED: nuclear transcription factor Y subunit C-2 | ||||
| Swissprot | Q8LCG7 | 3e-40 | NFYC2_ARATH; Nuclear transcription factor Y subunit C-2 | ||||
| TrEMBL | A0A438G9G7 | 3e-47 | A0A438G9G7_VITVI; Nuclear transcription factor Y subunit C-2 | ||||
| TrEMBL | A5B007 | 3e-48 | A5B007_VITVI; Uncharacterized protein | ||||
| STRING | VIT_19s0085g00520.t01 | 6e-49 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP315 | 17 | 117 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G56170.2 | 1e-42 | nuclear factor Y, subunit C2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GSVIVT01036760001 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




