![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSVIVT01037022001 | ||||||||
| Common Name | LOC100263465, VIT_03s0088g00610 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 220aa MW: 24661.5 Da PI: 8.8292 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 65.2 | 6.9e-21 | 18 | 63 | 4 | 49 |
-SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
SRF-TF 4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
k qvtfskR+ g++KKA+EL++LC+a++a+++fs+ gk++ +
GSVIVT01037022001 18 PKKNHLQVTFSKRKSGLFKKASELCTLCGANIAILVFSPGGKVFSF 63
5667789************************************987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 23.745 | 7 | 67 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 4.1E-31 | 7 | 66 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00120 | 4.84E-30 | 8 | 66 | No hit | No description |
| SuperFamily | SSF55455 | 1.83E-24 | 8 | 80 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 9.2E-18 | 9 | 29 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.4E-23 | 16 | 63 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 9.2E-18 | 29 | 44 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 9.2E-18 | 44 | 65 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 220 aa Download sequence Send to blast |
MVEKSSKGRQ KIEIAKIPKK NHLQVTFSKR KSGLFKKASE LCTLCGANIA ILVFSPGGKV 60 FSFGHPDVRY IVYSFFANIP PTKRSDLNLI EAHDQNASIH KLNLQLAEVL NQLEAEKKRG 120 EILGQIRASQ GQCWWEAPID ELSLFELQQL KVSMEELKKI VVSQAELLLM EGNANPSTFN 180 KVNGYPMVDD FEFERKLSEI HGLSIVPHVH NFGHGLGFF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3kov_A | 7e-15 | 8 | 92 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3kov_B | 7e-15 | 8 | 92 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3kov_I | 7e-15 | 8 | 92 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3kov_J | 7e-15 | 8 | 92 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3p57_A | 7e-15 | 8 | 92 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3p57_B | 7e-15 | 8 | 92 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3p57_C | 7e-15 | 8 | 92 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3p57_D | 7e-15 | 8 | 92 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3p57_I | 7e-15 | 8 | 92 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3p57_J | 7e-15 | 8 | 92 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed during the syncytial endosperm development. {ECO:0000269|PubMed:18334668}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in the endosperm but not in the embryo. Detected in young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:18334668}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM440172 | 0.0 | AM440172.2 Vitis vinifera contig VV78X025022.2, whole genome shotgun sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002270816.1 | 1e-161 | PREDICTED: agamous-like MADS-box protein AGL62 | ||||
| Swissprot | Q9FKK2 | 9e-50 | AGL62_ARATH; Agamous-like MADS-box protein AGL62 | ||||
| TrEMBL | A0A438JMK5 | 1e-160 | A0A438JMK5_VITVI; Agamous-like MADS-box protein AGL62 | ||||
| TrEMBL | D7T3M9 | 1e-160 | D7T3M9_VITVI; Uncharacterized protein | ||||
| STRING | VIT_03s0088g00610.t01 | 1e-161 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP16 | 17 | 761 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G60440.1 | 4e-52 | AGAMOUS-like 62 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GSVIVT01037022001 |
| Entrez Gene | 100263465 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




