PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_A01G0806

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

NAC

Protein Properties

Length: 61aa MW: 7403.66 Da PI: 9.0026

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_A01G0806	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	51.2	4.1e-16	10	56	1	48
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48 +p GfrFhPt+eel+ +yL+kkv+ + ++l +vi+evd++k+ PwdL+ Gh_A01G0806 10 VPLGFRFHPTEEELLYYYLRKKVSFEAIDL-DVIREVDLNKLVPWDLK 56 589*************************.9*************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.26E-15	6	58	IPR003441	NAC domain
PROSITE profile	PS51005	18.354	10	61	IPR003441	NAC domain
Pfam	PF02365	9.0E-7	11	35	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 61 aa Download sequence Send to blast
MAARNRQLLV PLGFRFHPTE EELLYYYLRK KVSFEAIDLD VIREVDLNKL VPWDLKGQWR 60 I

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: First expressed at early heart stage onward in all root basal daughter cells resulting from horizontal divisions in the COL progenitors and is later maintained in these cells. Present in root stem cell daughters and accumulates in maturing root cap layers. Detectable from very early stages of lateral root development. {ECO:0000269\|PubMed:19081078, ECO:0000269\|PubMed:20197506}.
Uniprot	TISSUE SPECIFICITY: Accumulates in maturing root cap cells, in both COL and LRC cells. {ECO:0000269\|PubMed:19081078, ECO:0000269\|PubMed:20197506}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription regulator. Together with BRN1 and BRN2, regulates cellular maturation of root cap. Represses stem cell-like divisions in the root cap daughter cells, and thus promotes daughter cell fate. Inhibits expression of its positive regulator FEZ in a feedback loop for controlled switches in cell division plane. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269\|PubMed:19081078, ECO:0000269\|PubMed:20197506}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By FEZ in oriented-divised root cap stem cells. {ECO:0000269\|PubMed:19081078}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007213444.2	1e-28	protein SOMBRERO isoform X1
Refseq	XP_009363295.1	1e-28	PREDICTED: protein SOMBRERO
Refseq	XP_009368592.1	1e-28	PREDICTED: protein SOMBRERO-like
Refseq	XP_020418176.1	1e-28	protein SOMBRERO isoform X2
Refseq	XP_021811645.1	1e-28	protein SOMBRERO isoform X1
Refseq	XP_021811646.1	1e-28	protein SOMBRERO isoform X1
Refseq	XP_021811647.1	1e-28	protein SOMBRERO isoform X1
Refseq	XP_021811648.1	1e-28	protein SOMBRERO isoform X1
Refseq	XP_021811649.1	1e-28	protein SOMBRERO isoform X2
Swissprot	Q9MA17	4e-25	SMB_ARATH; Protein SOMBRERO
TrEMBL	A0A0D2R439	2e-29	A0A0D2R439_GOSRA; Uncharacterized protein (Fragment)
TrEMBL	A0A251PJL6	2e-27	A0A251PJL6_PRUPE; Uncharacterized protein
TrEMBL	A0A251PJN5	2e-27	A0A251PJN5_PRUPE; Uncharacterized protein
TrEMBL	A0A314ZIC4	2e-27	A0A314ZIC4_PRUYE; Protein SOMBRERO isoform X1
TrEMBL	M5WZ81	2e-27	M5WZ81_PRUPE; Uncharacterized protein
STRING	Gorai.002G111200.1	2e-29	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7967	13	40

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G79580.3	2e-27	NAC family protein

Publications ? help Back to Top
Fendrych M, et al. Programmed cell death controlled by ANAC033/SOMBRERO determines root cap organ size in Arabidopsis. Curr. Biol., 2014. 24(9): p. 931-40 [PMID:24726156] Bennett T,van den Toorn A,Willemsen V,Scheres B Precise control of plant stem cell activity through parallel regulatory inputs. Development, 2014. 141(21): p. 4055-64 [PMID:25256342] Karve R,Suárez-Román F,Iyer-Pascuzzi AS The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release. Plant Physiol., 2016. 171(3): p. 2101-11 [PMID:27221617] Kamiya M, et al. Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis. Development, 2016. 143(21): p. 4063-4072 [PMID:27803060]