PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_A03G1332

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

NAC

Protein Properties

Length: 255aa MW: 29034 Da PI: 9.3638

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_A03G1332	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	166.1	1.3e-51	15	139	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 lppGfrFhPtdeelvv+yL++kv + +l++ ++i+evd++k++PwdLp e+e yfFs+r+ ky++g+r+nrat sgyWkatg dk+++s ++ Gh_A03G1332 15 LPPGFRFHPTDEELVVQYLRRKVLSWPLPA-SIIPEVDVCKADPWDLPGD---LEQERYFFSTREAKYPNGNRSNRATLSGYWKATGIDKQIVSCsGN 108 79**************************.89***********54...46799******************************997578 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 ++vg+kktLvfy+g+ p+g++tdW+mheyrl Gh_A03G1332 109 QVVGMKKTLVFYRGKPPEGTRTDWIMHEYRL 139 88*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.29E-60	10	172	IPR003441	NAC domain
PROSITE profile	PS51005	57.55	15	172	IPR003441	NAC domain
Pfam	PF02365	1.0E-26	16	139	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009651	Biological Process	response to salt stress
GO:0009737	Biological Process	response to abscisic acid
GO:0010089	Biological Process	xylem development
GO:0010150	Biological Process	leaf senescence
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 255 aa Download sequence Send to blast
MMAKLNFVKN GVLRLPPGFR FHPTDEELVV QYLRRKVLSW PLPASIIPEV DVCKADPWDL 60 PGDLEQERYF FSTREAKYPN GNRSNRATLS GYWKATGIDK QIVSCSGNQV VGMKKTLVFY 120 RGKPPEGTRT DWIMHEYRLV TADTCNAPHK KNQTQNHVVA VENWVLCRIF LKKRSGATKR 180 EDDGLQCCNE KGVGKARRKS PVFYEFLSKE RTDLYLAPAS SSSCSSGITQ VSNDNADDHE 240 ESSSCNSFPY FRRKP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	6e-53	13	179	15	171	NO APICAL MERISTEM PROTEIN
1ut4_B	6e-53	13	179	15	171	NO APICAL MERISTEM PROTEIN
1ut7_A	6e-53	13	179	15	171	NO APICAL MERISTEM PROTEIN
1ut7_B	6e-53	13	179	15	171	NO APICAL MERISTEM PROTEIN
3swm_A	7e-53	13	179	18	174	NAC domain-containing protein 19
3swm_B	7e-53	13	179	18	174	NAC domain-containing protein 19
3swm_C	7e-53	13	179	18	174	NAC domain-containing protein 19
3swm_D	7e-53	13	179	18	174	NAC domain-containing protein 19
3swp_A	7e-53	13	179	18	174	NAC domain-containing protein 19
3swp_B	7e-53	13	179	18	174	NAC domain-containing protein 19
3swp_C	7e-53	13	179	18	174	NAC domain-containing protein 19
3swp_D	7e-53	13	179	18	174	NAC domain-containing protein 19
4dul_A	6e-53	13	179	15	171	NAC domain-containing protein 19
4dul_B	6e-53	13	179	15	171	NAC domain-containing protein 19
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Ghi.3574	0.0	boll\| ovule

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Up-regulated during xylem vessel element differentiation. {ECO:0000269\|PubMed:20388856}.
Uniprot	TISSUE SPECIFICITY: Expressed in xylem and phloem cells in roots and inflorescence stems (PubMed:20388856). Highly expressed in senescent leaves. Expressed in roots, and abscission and dehiscence tissues, such as axils of bracts and abscission zones in cauline leaves and siliques (PubMed:21673078). {ECO:0000269\|PubMed:20388856, ECO:0000269\|PubMed:21673078}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269\|PubMed:20388856, ECO:0000269\|PubMed:21673078, ECO:0000269\|PubMed:24442717}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00507	DAP	Transfer from AT5G13180	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269\|PubMed:21673078}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KC110642	0.0	KC110642.1 Gossypium hirsutum NAC protein 7 (NAC7) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016666242.1	0.0	PREDICTED: NAC domain-containing protein 83-like
Refseq	XP_017643681.1	0.0	PREDICTED: NAC domain-containing protein 83-like
Swissprot	Q9FY93	3e-97	NAC83_ARATH; NAC domain-containing protein 83
TrEMBL	A0A1U8HJJ6	0.0	A0A1U8HJJ6_GOSHI; NAC domain-containing protein 83-like
STRING	Gorai.005G195300.1	0.0	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM1806	27	86

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G13180.1	6e-99	NAC domain containing protein 83

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]