PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_A04G1063

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

bZIP

Protein Properties

Length: 169aa MW: 19854.4 Da PI: 6.3939

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_A04G1063	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	41.4	3.1e-13	38	94	7	63
HHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 7 errkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 +r+++NRe+ArrsR RK++ ++ L + +L+++N++ + +++ +++ +++se+ Gh_A04G1063 38 RKRMISNRESARRSRMRKQKHLDDLMTQLTQLQKQNHEIITNINFTTQHLLNVESEN 94 69***************************************9999999988888877 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	3.2E-13	37	96	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	6.6E-10	37	83	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	9.381	37	97	IPR004827	Basic-leucine zipper domain
CDD	cd14702	2.56E-20	37	87	No hit	No description
SuperFamily	SSF57959	4.88E-12	37	88	No hit	No description
Gene3D	G3DSA:1.20.5.170	3.0E-10	38	111	No hit	No description
PROSITE pattern	PS00036	0	39	54	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 169 aa Download sequence Send to blast
MFPILSEIFF SGFMINSTFI RRTHLVQSFS VVFLYWKRKR MISNRESARR SRMRKQKHLD 60 DLMTQLTQLQ KQNHEIITNI NFTTQHLLNV ESENSVLRAQ LNELTHRLQS LNEIISFLND 120 DHGDDDDDDD KTSIDFTQPA VADTAFLNPF HLAFLNQPIM ASADNTFQY

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	48	55	RRSRMRKQ

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Ghi.5106	1e-156	boll\| ovule\| root

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in the micropylar endosperm and radicle tip in early germinating seeds. {ECO:0000269\|PubMed:23461773}.
Uniprot	TISSUE SPECIFICITY: Highly expressed in stems and flowers (PubMed:9620274). Expressed in root tips, cotyledons, leaf vasculature, embryos, apical parts of siliques and funiculi (PubMed:9721683). {ECO:0000269\|PubMed:9620274, ECO:0000269\|PubMed:9721683}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269\|PubMed:23461773}.
UniProt	Transcription factor that binds to the DNA sequence 5'-ACTCAT-3' in target gene promoters. Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879). Positively regulates the expression of ASN1 and POX2/PRODH2 genes, which are involved in amino acid metabolism (PubMed:18088315). Regulates several metabolic pathways such as myo-inositol, raffinose and trehalose. Regulates several trehalose metabolism genes, including TRE1, TPP5 and TPP6 (PubMed:21534971). Mediates recruitment of the histone acetylation machinery to activate auxin-induced transcription. Interacts with ADA2B adapter protein to promote ADA2B-mediated recruitment of SAGA-like histone acetyltransferase complexes to specific auxin-responsive genes (PubMed:24861440). {ECO:0000269\|PubMed:15047879, ECO:0000269\|PubMed:18088315, ECO:0000269\|PubMed:21534971, ECO:0000269\|PubMed:24861440}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By light (PubMed:9620274). Induced by hypoosmolarity (PubMed:15047879). Repressed by sucrose (at protein level) (PubMed:9721683, PubMed:15208401). {ECO:0000269\|PubMed:15047879, ECO:0000269\|PubMed:15208401, ECO:0000269\|PubMed:9620274, ECO:0000269\|PubMed:9721683}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JX964038	3e-48	JX964038.1 Gossypium hirsutum clone NBRI_TRANS-307 microsatellite sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016739306.1	3e-93	PREDICTED: bZIP transcription factor 53-like
Swissprot	C0Z2L5	4e-38	BZP44_ARATH; bZIP transcription factor 44
Swissprot	O65683	3e-38	BZP11_ARATH; bZIP transcription factor 11
TrEMBL	A0A0D2V5R4	1e-113	A0A0D2V5R4_GOSRA; Uncharacterized protein (Fragment)
STRING	Gorai.012G155000.1	1e-115	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM501	28	154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G34590.1	2e-34	G-box binding factor 6

Publications ? help Back to Top
Mair A, et al. SnRK1-triggered switch of bZIP63 dimerization mediates the low-energy response in plants. Elife, 2016. [PMID:26263501] Sagor GH, et al. A novel strategy to produce sweeter tomato fruits with high sugar contents by fruit-specific expression of a single bZIP transcription factor gene. Plant Biotechnol. J., 2016. 14(4): p. 1116-26 [PMID:26402509] Walper E,Weiste C,Mueller MJ,Hamberg M,Dröge-Laser W Screen Identifying Arabidopsis Transcription Factors Involved in the Response to 9-Lipoxygenase-Derived Oxylipins. PLoS ONE, 2016. 11(4): p. e0153216 [PMID:27073862] Wang XY, et al. Metabolomic analysis reveals the relationship between AZI1 and sugar signaling in systemic acquired resistance of Arabidopsis. Plant Physiol. Biochem., 2016. 107: p. 273-287 [PMID:27337039] Weiste C, et al. The Arabidopsis bZIP11 transcription factor links low-energy signalling to auxin-mediated control of primary root growth. PLoS Genet., 2017. 13(2): p. e1006607 [PMID:28158182] Yamashita Y, et al. Sucrose sensing through nascent peptide-meditated ribosome stalling at the stop codon of Arabidopsis bZIP11 uORF2. FEBS Lett., 2017. 591(9): p. 1266-1277 [PMID:28369795] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Lee DH,Park SJ,Ahn CS,Pai HS MRF Family Genes Are Involved in Translation Control, Especially under Energy-Deficient Conditions, and Their Expression and Functions Are Modulated by the TOR Signaling Pathway. Plant Cell, 2017. 29(11): p. 2895-2920 [PMID:29084871] Pedrotti L, et al. Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness. Plant Cell, 2018. 30(2): p. 495-509 [PMID:29348240]