PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_A06G0764

Common Name

WRKY112

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

WRKY

Protein Properties

Length: 157aa MW: 18401.1 Da PI: 4.8098

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_A06G0764	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	99	3e-31	96	154	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K vk+s++pr+YYrC+ gCpvkk+ver++edp++v++tYeg Hnh+ Gh_A06G0764 96 LDDGYRWRKYGKKWVKNSPNPRNYYRCSIDGCPVKKRVERDKEDPSYVITTYEGIHNHR 154 59********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	9.0E-34	83	155	IPR003657	WRKY domain
SuperFamily	SSF118290	1.1E-28	89	154	IPR003657	WRKY domain
PROSITE profile	PS50811	29.918	91	156	IPR003657	WRKY domain
SMART	SM00774	1.3E-35	96	155	IPR003657	WRKY domain
Pfam	PF03106	8.5E-25	97	154	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009867	Biological Process	jasmonic acid mediated signaling pathway
GO:0050832	Biological Process	defense response to fungus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 157 aa Download sequence Send to blast
MSSSNFNPPD SPESDRADQS NFEFPEDWTL DGWLEDYPET IITGPIQFPF NQADEVNNDS 60 ARTSGLLQVP ENETARERRD VRERFAFKTK SEVEILDDGY RWRKYGKKWV KNSPNPRNYY 120 RCSIDGCPVK KRVERDKEDP SYVITTYEGI HNHRSVS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	3e-26	86	153	7	74	Probable WRKY transcription factor 4
2lex_A	3e-26	86	153	7	74	Probable WRKY transcription factor 4
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Ghi.16248	1e-115	leaf\| ovule

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00531	DAP	Transfer from AT5G26170	Download

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF669803	0.0	KF669803.1 Gossypium hirsutum WRKY transcription factor 112 (WRKY112) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016754871.1	1e-114	PREDICTED: probable WRKY transcription factor 50
Refseq	XP_017636896.1	1e-114	PREDICTED: probable WRKY transcription factor 50
Swissprot	Q8VWQ5	1e-43	WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBL	A0A068LD75	1e-113	A0A068LD75_GOSHI; WRKY transcription factor 112
TrEMBL	A0A2P5XWG0	1e-113	A0A2P5XWG0_GOSBA; Uncharacterized protein
STRING	Gorai.010G098000.1	1e-112	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM6121	27	47

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G26170.1	4e-46	WRKY DNA-binding protein 50

Publications ? help Back to Top
Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821] Dou L, et al. Genome-wide analysis of the WRKY gene family in cotton. Mol. Genet. Genomics, 2014. 289(6): p. 1103-21 [PMID:24942461]