PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A06G1847
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 192aa    MW: 22206.9 Da    PI: 6.6835
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A06G1847genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.51.4e-1353111563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  ++ +r+++NRe+ArrsR RK++ ++eL   v +L + N +   +++  ++++ ++++e+
  Gh_A06G1847  53 RKRKRMESNRESARRSRMRKQKHLDELMAQVTQLVKDNNQILTTINFTTQHYINMEAEN 111
                  6789*****************************************99999999998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.1E-104598No hitNo description
SMARTSM003386.1E-1946113IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.26651114IPR004827Basic-leucine zipper domain
PfamPF001704.9E-1153111IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.24E-1253107No hitNo description
CDDcd147024.87E-1954104No hitNo description
PROSITE patternPS0003605671IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MSPVVSEILR SGFMINSSLR RRTHLVQSFS VVFLYCGNSM SNSVSEEDLH NQRKRKRMES  60
NRESARRSRM RKQKHLDELM AQVTQLVKDN NQILTTINFT TQHYINMEAE NSVLRAQMME  120
LSQRLESLNE ILNYLNSGTN SNNSNDGFET SEGFETTSDE SFTTIISNHN NNPFVIMNQP  180
IIASSDMMMF QY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15273RKRKRMESNRESARRSRMRKQK
26572RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.56300.0boll| ovule
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the micropylar endosperm and radicle tip in early germinating seeds. {ECO:0000269|PubMed:23461773}.
UniprotTISSUE SPECIFICITY: Highly expressed in stems and flowers (PubMed:9620274). Expressed in root tips, cotyledons, leaf vasculature, embryos, apical parts of siliques and funiculi (PubMed:9721683). {ECO:0000269|PubMed:9620274, ECO:0000269|PubMed:9721683}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269|PubMed:23461773}.
UniProtTranscription factor that binds to the DNA sequence 5'-ACTCAT-3' in target gene promoters. Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879). Positively regulates the expression of ASN1 and POX2/PRODH2 genes, which are involved in amino acid metabolism (PubMed:18088315). Regulates several metabolic pathways such as myo-inositol, raffinose and trehalose. Regulates several trehalose metabolism genes, including TRE1, TPP5 and TPP6 (PubMed:21534971). Mediates recruitment of the histone acetylation machinery to activate auxin-induced transcription. Interacts with ADA2B adapter protein to promote ADA2B-mediated recruitment of SAGA-like histone acetyltransferase complexes to specific auxin-responsive genes (PubMed:24861440). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:18088315, ECO:0000269|PubMed:21534971, ECO:0000269|PubMed:24861440}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By light (PubMed:9620274). Induced by hypoosmolarity (PubMed:15047879). Repressed by sucrose (at protein level) (PubMed:9721683, PubMed:15208401). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:15208401, ECO:0000269|PubMed:9620274, ECO:0000269|PubMed:9721683}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016748735.11e-109PREDICTED: bZIP transcription factor 53-like
SwissprotC0Z2L56e-40BZP44_ARATH; bZIP transcription factor 44
SwissprotO656835e-40BZP11_ARATH; bZIP transcription factor 11
TrEMBLA0A0D2U3U91e-135A0A0D2U3U9_GOSRA; Uncharacterized protein
STRINGGorai.010G008000.11e-136(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.13e-39basic leucine-zipper 44
Publications ? help Back to Top
  1. Mair A, et al.
    SnRK1-triggered switch of bZIP63 dimerization mediates the low-energy response in plants.
    Elife, 2016.
    [PMID:26263501]
  2. Sagor GH, et al.
    A novel strategy to produce sweeter tomato fruits with high sugar contents by fruit-specific expression of a single bZIP transcription factor gene.
    Plant Biotechnol. J., 2016. 14(4): p. 1116-26
    [PMID:26402509]
  3. Walper E,Weiste C,Mueller MJ,Hamberg M,Dröge-Laser W
    Screen Identifying Arabidopsis Transcription Factors Involved in the Response to 9-Lipoxygenase-Derived Oxylipins.
    PLoS ONE, 2016. 11(4): p. e0153216
    [PMID:27073862]
  4. Wang XY, et al.
    Metabolomic analysis reveals the relationship between AZI1 and sugar signaling in systemic acquired resistance of Arabidopsis.
    Plant Physiol. Biochem., 2016. 107: p. 273-287
    [PMID:27337039]
  5. Weiste C, et al.
    The Arabidopsis bZIP11 transcription factor links low-energy signalling to auxin-mediated control of primary root growth.
    PLoS Genet., 2017. 13(2): p. e1006607
    [PMID:28158182]
  6. Yamashita Y, et al.
    Sucrose sensing through nascent peptide-meditated ribosome stalling at the stop codon of Arabidopsis bZIP11 uORF2.
    FEBS Lett., 2017. 591(9): p. 1266-1277
    [PMID:28369795]
  7. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  8. Lee DH,Park SJ,Ahn CS,Pai HS
    MRF Family Genes Are Involved in Translation Control, Especially under Energy-Deficient Conditions, and Their Expression and Functions Are Modulated by the TOR Signaling Pathway.
    Plant Cell, 2017. 29(11): p. 2895-2920
    [PMID:29084871]
  9. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]