![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gh_A08G1630 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 80aa MW: 8824.08 Da PI: 4.4798 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 76.4 | 3.9e-24 | 1 | 61 | 38 | 98 |
NF-YC 38 misaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
mis e+P+++skacelfi elt rsw+ + + krrtl+k d+a+av td fdflv+ v +
Gh_A08G1630 1 MISGESPIVFSKACELFIKELTQRSWMVTMQGKRRTLNKEDVASAVMATDLFDFLVNLVSE 61
8*******************************************************99976 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 1.37E-17 | 1 | 60 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 1.7E-20 | 1 | 60 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 5.2E-11 | 2 | 46 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 80 aa Download sequence Send to blast |
MISGESPIVF SKACELFIKE LTQRSWMVTM QGKRRTLNKE DVASAVMATD LFDFLVNLVS 60 ESGHSGEAPP PLELDTFTSS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_B | 6e-22 | 1 | 59 | 35 | 93 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017624675.1 | 3e-53 | PREDICTED: nuclear transcription factor Y subunit C-2-like | ||||
| Swissprot | Q9ZVL3 | 1e-20 | NFYC3_ARATH; Nuclear transcription factor Y subunit C-3 | ||||
| TrEMBL | A0A2P5WIS6 | 7e-52 | A0A2P5WIS6_GOSBA; Uncharacterized protein | ||||
| STRING | Gorai.004G209900.1 | 2e-51 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM17140 | 9 | 11 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G54830.3 | 5e-23 | nuclear factor Y, subunit C3 | ||||




