PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_A10G2217

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

SBP

Protein Properties

Length: 141aa MW: 16111.8 Da PI: 8.0745

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_A10G2217	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	136.6	7.3e-43	55	132	1	78
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 +Cqve+C+ad+++ak+yhrrhkvCe+h+ka+vv v+g++qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk+++ Gh_A10G2217 55 ACQVENCTADMTDAKRYHRRHKVCEFHAKAAVVRVAGIHQRFCQQCSRFHELSEFDETKRSCRRRLAGHNERRRKSSS 132 5**************************************************************************976 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PIRSF	PIRSF037575	1.4E-61	1	141	IPR017238	Squamosa promoter-binding protein
Gene3D	G3DSA:4.10.1100.10	1.1E-33	51	117	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	32.59	53	130	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	1.03E-39	54	134	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	7.3E-33	56	129	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009911	Biological Process	positive regulation of flower development
GO:0010228	Biological Process	vegetative to reproductive phase transition of meristem
GO:0010229	Biological Process	inflorescence development
GO:0010321	Biological Process	regulation of vegetative phase change
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046872	Molecular Function	metal ion binding

Sequence ? help Back to Top
Protein Sequence Length: 141 aa Download sequence Send to blast
MATSKAEGKR RLKEMGEEEE EEEEDEDNST TGDDDKKKKG KRGSSTVVGG SCLPACQVEN 60 CTADMTDAKR YHRRHKVCEF HAKAAVVRVA GIHQRFCQQC SRFHELSEFD ETKRSCRRRL 120 AGHNERRRKS SSEYHGEGSN F

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	2e-38	49	129	4	84	squamosa promoter binding protein-like 4
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Ghi.13781	0.0	boll

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00290	DAP	Transfer from AT2G33810	Download

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JN795132	0.0	JN795132.1 Gossypium hirsutum SPL3 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016711047.1	4e-99	PREDICTED: squamosa promoter-binding-like protein 3
Swissprot	Q38741	8e-54	SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBL	A0A1U8L8X1	9e-98	A0A1U8L8X1_GOSHI; Squamosa promoter-binding-like protein
STRING	Gorai.011G029400.1	3e-76	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM868	28	118

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G33810.1	6e-44	squamosa promoter binding protein-like 3

Publications ? help Back to Top
Klein J,Saedler H,Huijser P A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA. Mol. Gen. Genet., 1996. 250(1): p. 7-16 [PMID:8569690]