 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Gh_A11G0283 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
| Family |
ZF-HD |
| Protein Properties |
Length: 104aa MW: 11518.1 Da PI: 9.7469 |
| Description |
ZF-HD family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Gh_A11G0283 | genome | NAU-NBI | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | ZF-HD_dimer | 105.7 | 2.7e-33 | 24 | 80 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
+vrY eC+kNhAa++Gg+avDGC+Efm+s + egt+ al+CaACgCHRnFHRreve+e
Gh_A11G0283 24 NVRYGECQKNHAANIGGYAVDGCREFMAS-DVEGTTGALTCAACGCHRNFHRREVETE 80
79**************************9.9999********************9875 PP
|
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | TISSUE SPECIFICITY: Mostly expressed in roots and stems, present in siliques and seedlings, and weakly observed in petioles, leaves and flowers. {ECO:0000269|PubMed:16412086}. |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, such as ZHD5, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by preventing the expression of genes involved in gibberellic acid (GA), auxin and brassinosteroid signaling and by promoting the expression of abscisic acid (ABA)-responsive genes. Regulates several development aspects, including photomorphogenesis, apical dominance, longevity, flower morphology and fertility, as well as root and stem elongation. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:16412086, ECO:0000269|PubMed:21059647, ECO:0000269|PubMed:21455630}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | JX590490 | 8e-72 | JX590490.1 Gossypium hirsutum clone NBRI_GE25411 microsatellite sequence. |
