![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gh_A11G0348 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 186aa MW: 21419.5 Da PI: 10.0303 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 145 | 4.1e-45 | 12 | 135 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98
lppGfrF+Pt+eelv +yLk k+ + +l++ ++i++++i++++PwdLp + +e yfFs ++ ky+ g+r n at+sgyWkatg+dk+++s++++
Gh_A11G0348 12 LPPGFRFQPTEEELVFQYLKCKAFSFPLPA-SIIPDLNICNFDPWDLPGDL---GEERYFFSVKEAKYKIGNRINWATASGYWKATGSDKQIISRRNQ 105
79****************************.89***************543...5799**************************************** PP
NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128
+ g++ktLvf+ g+ p+g +tdW+mheyrl
Gh_A11G0348 106 VAGMRKTLVFHMGKPPHGLRTDWIMHEYRL 135
****************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 4.84E-49 | 8 | 143 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 45.451 | 12 | 158 | IPR003441 | NAC domain |
| Pfam | PF02365 | 5.0E-23 | 13 | 135 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 186 aa Download sequence Send to blast |
MNSLRLNGLR KLPPGFRFQP TEEELVFQYL KCKAFSFPLP ASIIPDLNIC NFDPWDLPGD 60 LGEERYFFSV KEAKYKIGNR INWATASGYW KATGSDKQII SRRNQVAGMR KTLVFHMGKP 120 PHGLRTDWIM HEYRLVNVPN NDFNSANNPM MQAKKFSIGS ATTQDNLDDD NAEDKKDKKK 180 KFLQKA |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 9e-39 | 12 | 137 | 17 | 144 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 9e-39 | 12 | 137 | 17 | 144 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 9e-39 | 12 | 137 | 17 | 144 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 9e-39 | 12 | 137 | 17 | 144 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 9e-39 | 12 | 137 | 20 | 147 | NAC domain-containing protein 19 |
| 3swm_B | 9e-39 | 12 | 137 | 20 | 147 | NAC domain-containing protein 19 |
| 3swm_C | 9e-39 | 12 | 137 | 20 | 147 | NAC domain-containing protein 19 |
| 3swm_D | 9e-39 | 12 | 137 | 20 | 147 | NAC domain-containing protein 19 |
| 3swp_A | 9e-39 | 12 | 137 | 20 | 147 | NAC domain-containing protein 19 |
| 3swp_B | 9e-39 | 12 | 137 | 20 | 147 | NAC domain-containing protein 19 |
| 3swp_C | 9e-39 | 12 | 137 | 20 | 147 | NAC domain-containing protein 19 |
| 3swp_D | 9e-39 | 12 | 137 | 20 | 147 | NAC domain-containing protein 19 |
| 4dul_A | 9e-39 | 12 | 137 | 17 | 144 | NAC domain-containing protein 19 |
| 4dul_B | 9e-39 | 12 | 137 | 17 | 144 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Up-regulated during xylem vessel element differentiation. {ECO:0000269|PubMed:20388856}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in xylem and phloem cells in roots and inflorescence stems (PubMed:20388856). Highly expressed in senescent leaves. Expressed in roots, and abscission and dehiscence tissues, such as axils of bracts and abscission zones in cauline leaves and siliques (PubMed:21673078). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016708953.1 | 1e-114 | PREDICTED: NAC domain-containing protein 83-like | ||||
| Swissprot | Q9FY93 | 2e-63 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
| TrEMBL | A0A1U8L6E2 | 1e-112 | A0A1U8L6E2_GOSHI; NAC domain-containing protein 83-like | ||||
| STRING | Gorai.007G043900.1 | 1e-107 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM22074 | 4 | 5 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G13180.1 | 1e-65 | NAC domain containing protein 83 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




