PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_A11G1590

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

bZIP

Protein Properties

Length: 206aa MW: 23274.2 Da PI: 9.7739

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_A11G1590	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	45.2	2e-14	136	187	4	55
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 ++r +r++kNRe+A rsR+RK+ ++ eLe +v+ L +eN +Lk + e+l+ Gh_A11G1590 136 DRRHKRMIKNRESAARSRARKQVYTNELELEVAHLMEENARLKRQQEQLRVA 187 689****************************************999999765 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	4.4E-12	133	197	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	11.162	135	185	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	1.2E-12	137	185	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	7.1E-14	137	186	No hit	No description
SuperFamily	SSF57959	3.0E-11	137	185	No hit	No description
CDD	cd14707	3.32E-28	137	191	No hit	No description
PROSITE pattern	PS00036	0	140	155	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 206 aa Download sequence Send to blast
MEEVWKEINL ASLHDNSSSR EGLNPHNPHF ILQDFLARPF SKEPPTNRVS ANGDTTFLDS 60 PPPPPPATLL SLNSGPGFDF LDNSCPLRSK PRLQMQNNPI SDLSNMNCPF DALASPSGLA 120 CFDKKRFQDP DNNSGDRRHK RMIKNRESAA RSRARKQVYT NELELEVAHL MEENARLKRQ 180 QEQLRVAAAT PLSRKRTLQR TSTAPF

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Highly expressed in shoot apex. {ECO:0000269\|PubMed:16099979, ECO:0000269\|PubMed:16099980, ECO:0000269\|PubMed:25661797}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for the transition to flowering promoted by FT. {ECO:0000269\|PubMed:16099979, ECO:0000269\|PubMed:16099980}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016749607.1	1e-151	PREDICTED: protein FD-like, partial
Swissprot	Q84JK2	1e-65	FD_ARATH; Protein FD
TrEMBL	A0A1U8PEJ3	1e-150	A0A1U8PEJ3_GOSHI; protein FD-like
STRING	Gorai.007G191800.1	1e-135	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM1934	27	72

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G35900.1	6e-63	bZIP family protein

Publications ? help Back to Top
Ho WW,Weigel D Structural features determining flower-promoting activity of Arabidopsis FLOWERING LOCUS T. Plant Cell, 2014. 26(2): p. 552-64 [PMID:24532592] Ji H, et al. Downregulation of leaf flavin content induces early flowering and photoperiod gene expression in Arabidopsis. BMC Plant Biol., 2014. 14: p. 237 [PMID:25201173] Li L, et al. Expression of turtle riboflavin-binding protein represses mitochondrial electron transport gene expression and promotes flowering in Arabidopsis. BMC Plant Biol., 2014. 14: p. 381 [PMID:25547226] Sussmilch FC, et al. Pea VEGETATIVE2 Is an FD Homolog That Is Essential for Flowering and Compound Inflorescence Development. Plant Cell, 2015. 27(4): p. 1046-60 [PMID:25804541] Khan M, et al. Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis. Plant Physiol., 2015. 169(3): p. 2166-86 [PMID:26417006] Andrés F, et al. Floral Induction in Arabidopsis by FLOWERING LOCUS T Requires Direct Repression of BLADE-ON-PETIOLE Genes by the Homeodomain Protein PENNYWISE. Plant Physiol., 2015. 169(3): p. 2187-99 [PMID:26417007] Kawamoto N,Endo M,Araki T Expression of a kinase-dead form of CPK33 involved in florigen complex formation causes delayed flowering. Plant Signal Behav, 2015. 10(12): p. e1086856 [PMID:26440648] Zhang L,Yu H,Lin S,Gao Y Molecular Characterization of FT and FD Homologs from Eriobotrya deflexa Nakai forma koshunensis. Front Plant Sci, 2016. 7: p. 8 [PMID:26834775] Hou CJ,Yang CH Comparative analysis of the pteridophyte Adiantum MFT ortholog reveals the specificity of combined FT/MFT C and N terminal interaction with FD for the regulation of the downstream gene AP1. Plant Mol. Biol., 2016. 91(4-5): p. 563-79 [PMID:27216814] Jung JH,Lee HJ,Ryu JY,Park CM SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering. Mol Plant, 2016. 9(12): p. 1647-1659 [PMID:27815142] Jang S,Li HY,Kuo ML Ectopic expression of Arabidopsis FD and FD PARALOGUE in rice results in dwarfism with size reduction of spikelets. Sci Rep, 2017. 7: p. 44477 [PMID:28290557]