PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A12G0557
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 154aa    MW: 18258.7 Da    PI: 8.8763
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A12G0557genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.41.1e-5661361129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPtd+elv +yL+kkv+++k++l +vi+++d+y++ePwdL++     ++e+kewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+v+++
  Gh_A12G0557   6 VPPGFRFHPTDDELVGYYLRKKVASQKIDL-DVITDIDLYRIEPWDLQErcrIGYEEQKEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKAVYDN 102
                  69****************************.9***************953432234677*************************************** PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                  k++l+g++ktLvfy+grap+g+ktdW+mheyrle
  Gh_A12G0557 103 KSKLIGMRKTLVFYEGRAPNGHKTDWIMHEYRLE 136
                  ********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.89E-583142IPR003441NAC domain
PROSITE profilePS5100555.2646154IPR003441NAC domain
PfamPF023651.5E-297135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
MMESSVPPGF RFHPTDDELV GYYLRKKVAS QKIDLDVITD IDLYRIEPWD LQERCRIGYE  60
EQKEWYFFSH KDKKYPTGTR TNRATMAGFW KATGRDKAVY DNKSKLIGMR KTLVFYEGRA  120
PNGHKTDWIM HEYRLESDDN RPPQASTHII TIFN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-51313512140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
UniprotDEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
UniprotTISSUE SPECIFICITY: Detected in root protoxylem and metaxylem poles and in vessels of protoxylems, outermost metaxylems, inner metaxylems, shoots and hypocotyls (PubMed:18445131). Expressed in roots, hypocotyls, cotyledons and leaves. Present in developing xylems (PubMed:16103214, PubMed:16581911). Specifically expressed in vessels but not in interfascicular fibers in stems (PubMed:25148240). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:16581911, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:25148240}.
UniprotTISSUE SPECIFICITY: Expressed in root metaxylem pole and in shoot pre-procambium and procambium (PubMed:18445131). Present in root developing xylems (PubMed:16103214). Specifically expressed in vessels but not in interfascicular fibers in stems (PubMed:25148240). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:25148240}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by chitin (e.g. chitooctaose) (PubMed:17722694). Accumulates in plants exposed to callus induction medium (CIM) (PubMed:17581762). {ECO:0000269|PubMed:17581762, ECO:0000269|PubMed:17722694}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472200.0KC847220.1 Gossypium hirsutum NAC domain protein NAC43 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001314424.11e-109NAC domain-containing protein 37-like
SwissprotO655081e-93NAC76_ARATH; NAC domain-containing protein 76
SwissprotQ9SL417e-94NAC37_ARATH; NAC domain-containing protein 37
TrEMBLA0A2P5XXU51e-112A0A2P5XXU5_GOSBA; Uncharacterized protein
STRINGGorai.008G063600.11e-104(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36862661
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.13e-96vascular related NAC-domain protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Negi S,Tak H,Ganapathi TR
    Cloning and functional characterization of MusaVND1 using transgenic banana plants.
    Transgenic Res., 2015. 24(3): p. 571-85
    [PMID:25523085]
  4. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]