![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gh_A13G1230 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 115aa MW: 12959.6 Da PI: 9.8957 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 126.7 | 1.9e-39 | 15 | 111 | 1 | 98 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98
lppGfrFhPtdeelvv+yLkkk+++ +l++ +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+vl++kg+
Gh_A13G1230 15 LPPGFRFHPTDEELVVHYLKKKATSAPLPV-AIIAEVDLYKFDPWELPAKATFGEREWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLNSKGT 111
79****************************.88***************988899***************************************97655 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 1.57E-44 | 6 | 109 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 41.508 | 15 | 115 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.5E-18 | 16 | 107 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 115 aa Download sequence Send to blast |
MESTDSSTVS QRPNLPPGFR FHPTDEELVV HYLKKKATSA PLPVAIIAEV DLYKFDPWEL 60 PAKATFGERE WYFFSPRDRK YPNGARPNRA ATSGYWKATG TDKPVLNSKG TQKAS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 8e-51 | 14 | 105 | 14 | 105 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed throughout anthers from stages 8 to 12. Later confined to distal region of anthers from stage 13. {ECO:0000269|PubMed:16055634}. | |||||
| Uniprot | TISSUE SPECIFICITY: Stamen specific, in anthers from stage 8 (PubMed:15100403, PubMed:16055634). Expressed in the outer integument, but seems not expressed in the embryo at the torpedo stage (PubMed:18849494). {ECO:0000269|PubMed:15100403, ECO:0000269|PubMed:16055634, ECO:0000269|PubMed:18849494}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JQ914141 | 1e-172 | JQ914141.1 Gossypium hirsutum NAC domain protein 10 (NAC10) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016676067.1 | 2e-77 | PREDICTED: NAC transcription factor 56-like | ||||
| Swissprot | Q9LD44 | 8e-61 | NAC56_ARATH; NAC transcription factor 56 | ||||
| TrEMBL | A0A1U8IDB0 | 4e-76 | A0A1U8IDB0_GOSHI; NAC transcription factor 56-like | ||||
| STRING | Gorai.013G167100.1 | 6e-75 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM190 | 28 | 276 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G15510.1 | 3e-63 | NAC domain containing protein 2 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




