![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gh_D01G2107 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 176aa MW: 19083.3 Da PI: 8.2141 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 179.8 | 2.4e-56 | 29 | 123 | 1 | 95 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
vreq+rflPian+srimkk+lPanaki+kdaketvqecvsefisf+tseasdkcq+ekrktingddllwa+atlGfedy++plk+yl+kyre ++
Gh_D01G2107 29 VREQERFLPIANISRIMKKALPANAKIAKDAKETVQECVSEFISFITSEASDKCQKEKRKTINGDDLLWAMATLGFEDYIDPLKIYLTKYREGDT 123
59*****************************************************************************************9665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 9.4E-54 | 24 | 126 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.17E-39 | 32 | 125 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.8E-28 | 35 | 99 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.5E-21 | 63 | 81 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 66 | 82 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 2.5E-21 | 82 | 100 | No hit | No description |
| PRINTS | PR00615 | 2.5E-21 | 101 | 119 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 176 aa Download sequence Send to blast |
MATSAPVPAS PGGGGSHESG GEQSPRSNVR EQERFLPIAN ISRIMKKALP ANAKIAKDAK 60 ETVQECVSEF ISFITSEASD KCQKEKRKTI NGDDLLWAMA TLGFEDYIDP LKIYLTKYRE 120 GDTKGSVKGG DTFAKKDVQP GPNAQLVHQG SFSQGVYYGN SQSQSQAHMM ASDARH |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 1e-47 | 29 | 120 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 1e-47 | 29 | 120 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Ghi.7365 | 0.0 | boll| ovule | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers and mature rosettes. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY185541 | 1e-65 | AY185541.1 Gossypium barbadense clone 1__10 putative CCAAT-binding transcription factor gene, partial cds. | |||
| GenBank | AY185542 | 1e-65 | AY185542.1 Gossypium barbadense clone 2__10 putative CCAAT-binding transcription factor gene, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016687368.1 | 1e-118 | PREDICTED: nuclear transcription factor Y subunit B-10-like isoform X1 | ||||
| Swissprot | Q8VYK4 | 3e-82 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A0A0B0MYK5 | 1e-128 | A0A0B0MYK5_GOSAR; Nuclear transcription factor Y subunit B-10-like protein | ||||
| STRING | Gorai.002G250600.1 | 1e-117 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM1480 | 27 | 94 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G53340.1 | 5e-74 | nuclear factor Y, subunit B10 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




