![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gh_D02G1245 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | bHLH | ||||||||
| Protein Properties | Length: 93aa MW: 10648 Da PI: 9.3344 | ||||||||
| Description | bHLH family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HLH | 23.5 | 1e-07 | 19 | 59 | 14 | 54 |
HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
d+i + ++L+ l+P++ + + K+s + +L+++++YI+sL
Gh_D02G1245 19 DQITDLVSKLQHLIPELRRRRFDKVSTSKVLQETCNYIRSL 59
6899999*********87999999***************99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50888 | 10.15 | 5 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Pfam | PF00010 | 2.4E-5 | 19 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| SuperFamily | SSF47459 | 1.13E-8 | 19 | 76 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene3D | G3DSA:4.10.280.10 | 4.3E-9 | 19 | 73 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 93 aa Download sequence Send to blast |
MSGRRSRSKQ SSVSSITDDQ ITDLVSKLQH LIPELRRRRF DKVSTSKVLQ ETCNYIRSLH 60 REVEDLSDRL SQLLASTDSD SDQAAIIRSL LMQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that regulates light-mediated responses in day light conditions by binding and inhibiting the activity of the bHLH transcription factor HFR1, a critical regulator of light signaling and shade avoidance. Forms non-functional heterodimers with HFR1, causing liberation and activation of PIF4 from the transcriptionally inactive HFR1-PIF4 complex. {ECO:0000269|PubMed:16786307, ECO:0000269|PubMed:23224238}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Circadian regulation with a peak of expression at midday. {ECO:0000269|PubMed:16786307}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012478675.1 | 1e-58 | PREDICTED: transcription factor PRE6-like | ||||
| Refseq | XP_016691126.1 | 1e-58 | PREDICTED: transcription factor PRE6-like | ||||
| Swissprot | Q8GW32 | 9e-39 | PRE6_ARATH; Transcription factor PRE6 | ||||
| TrEMBL | A0A0D2SGN6 | 3e-57 | A0A0D2SGN6_GOSRA; Uncharacterized protein | ||||
| TrEMBL | A0A1U8JLH0 | 3e-57 | A0A1U8JLH0_GOSHI; transcription factor PRE6-like | ||||
| TrEMBL | A0A2P5QDX7 | 3e-57 | A0A2P5QDX7_GOSBA; Uncharacterized protein | ||||
| STRING | Gorai.005G139900.1 | 5e-58 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM259 | 28 | 225 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G26945.1 | 7e-41 | bHLH family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




