PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_D04G1642

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

bZIP

Protein Properties

Length: 169aa MW: 19882.6 Da PI: 6.7269

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_D04G1642	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	41.4	3.1e-13	38	94	7	63
HHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 7 errkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 +r+++NRe+ArrsR RK++ ++ L + +L+++N++ + +++ +++ +++se+ Gh_D04G1642 38 RKRMISNRESARRSRMRKQKHLDDLMTQLTQLQKQNHEIITNINFTTQHLLNVESEN 94 69***************************************9999999988888877 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	3.2E-13	37	96	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	9.381	37	97	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	6.6E-10	37	83	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	5.2E-12	37	88	No hit	No description
CDD	cd14702	1.02E-20	37	87	No hit	No description
Gene3D	G3DSA:1.20.5.170	3.0E-10	38	111	No hit	No description
PROSITE pattern	PS00036	0	39	54	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 169 aa Download sequence Send to blast
MFPILSEIFF SGFMINSTFI RRTHLVQSFS VVFLYWKRKR MISNRESARR SRMRKQKHLD 60 DLMTQLTQLQ KQNHEIITNI NFTTQHLLNV ESENSVLRAQ LNELTHRLQS LNEIISFLND 120 VHGDDDDDDD KTSIDFTQPA VADNIFLIPF HLAYLNQPIM ASADNTFQH

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	48	55	RRSRMRKQ

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Ghi.5106	1e-132	boll\| ovule\| root

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Highly expressed in stems and flowers (PubMed:9620274). Expressed in root tips, cotyledons, leaf vasculature, embryos, apical parts of siliques and funiculi (PubMed:9721683). {ECO:0000269\|PubMed:9620274, ECO:0000269\|PubMed:9721683}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the DNA sequence 5'-ACTCAT-3' in target gene promoters. Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879). Positively regulates the expression of ASN1 and POX2/PRODH2 genes, which are involved in amino acid metabolism (PubMed:18088315). Regulates several metabolic pathways such as myo-inositol, raffinose and trehalose. Regulates several trehalose metabolism genes, including TRE1, TPP5 and TPP6 (PubMed:21534971). Mediates recruitment of the histone acetylation machinery to activate auxin-induced transcription. Interacts with ADA2B adapter protein to promote ADA2B-mediated recruitment of SAGA-like histone acetyltransferase complexes to specific auxin-responsive genes (PubMed:24861440). {ECO:0000269\|PubMed:15047879, ECO:0000269\|PubMed:18088315, ECO:0000269\|PubMed:21534971, ECO:0000269\|PubMed:24861440}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By light (PubMed:9620274). Induced by hypoosmolarity (PubMed:15047879). Repressed by sucrose (at protein level) (PubMed:9721683, PubMed:15208401). {ECO:0000269\|PubMed:15047879, ECO:0000269\|PubMed:15208401, ECO:0000269\|PubMed:9620274, ECO:0000269\|PubMed:9721683}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JX964038	3e-72	JX964038.1 Gossypium hirsutum clone NBRI_TRANS-307 microsatellite sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016679557.1	4e-93	PREDICTED: bZIP transcription factor 53-like
Swissprot	O65683	6e-38	BZP11_ARATH; bZIP transcription factor 11
TrEMBL	A0A0D2V5R4	1e-112	A0A0D2V5R4_GOSRA; Uncharacterized protein (Fragment)
STRING	Gorai.012G155000.1	1e-114	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM501	28	154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G34590.1	8e-34	G-box binding factor 6

Publications ? help Back to Top
Mair A, et al. SnRK1-triggered switch of bZIP63 dimerization mediates the low-energy response in plants. Elife, 2016. [PMID:26263501] Sagor GH, et al. A novel strategy to produce sweeter tomato fruits with high sugar contents by fruit-specific expression of a single bZIP transcription factor gene. Plant Biotechnol. J., 2016. 14(4): p. 1116-26 [PMID:26402509] Walper E,Weiste C,Mueller MJ,Hamberg M,Dröge-Laser W Screen Identifying Arabidopsis Transcription Factors Involved in the Response to 9-Lipoxygenase-Derived Oxylipins. PLoS ONE, 2016. 11(4): p. e0153216 [PMID:27073862] Wang XY, et al. Metabolomic analysis reveals the relationship between AZI1 and sugar signaling in systemic acquired resistance of Arabidopsis. Plant Physiol. Biochem., 2016. 107: p. 273-287 [PMID:27337039] Weiste C, et al. The Arabidopsis bZIP11 transcription factor links low-energy signalling to auxin-mediated control of primary root growth. PLoS Genet., 2017. 13(2): p. e1006607 [PMID:28158182] Yamashita Y, et al. Sucrose sensing through nascent peptide-meditated ribosome stalling at the stop codon of Arabidopsis bZIP11 uORF2. FEBS Lett., 2017. 591(9): p. 1266-1277 [PMID:28369795] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Lee DH,Park SJ,Ahn CS,Pai HS MRF Family Genes Are Involved in Translation Control, Especially under Energy-Deficient Conditions, and Their Expression and Functions Are Modulated by the TOR Signaling Pathway. Plant Cell, 2017. 29(11): p. 2895-2920 [PMID:29084871] Pedrotti L, et al. Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness. Plant Cell, 2018. 30(2): p. 495-509 [PMID:29348240]