![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gh_D04G1749 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 96aa MW: 11177.7 Da PI: 9.0721 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 116.8 | 2.2e-36 | 8 | 95 | 1 | 89 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89
lppGfrFhPtdeel+ +yL kk++++++++ ++i++vdiyk++PwdLp k+ +ekewyfFs+rd+ky++g r+nrat+ g+Wkatg+d
Gh_D04G1749 8 LPPGFRFHPTDEELILHYLMKKLSSSPFPV-SIIADVDIYKFDPWDLPDKAVLGEKEWYFFSPRDRKYPNGARPNRATSPGFWKATGRD 95
79****************************.89***************7777899********************************87 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 1.83E-41 | 5 | 95 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 40.392 | 8 | 96 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.7E-16 | 9 | 94 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
MRHPHSSLPP GFRFHPTDEE LILHYLMKKL SSSPFPVSII ADVDIYKFDP WDLPDKAVLG 60 EKEWYFFSPR DRKYPNGARP NRATSPGFWK ATGRDC |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 3e-43 | 7 | 95 | 14 | 102 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds to the promoter of ACO5, an ACC oxidase involved in ethylene biosynthesis. Mediates waterlogging-induced hyponastic leaf movement, and cell expansion in abaxial cells of the basal petiole region, by directly regulating the expression of ACO5 (PubMed:24363315). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:24363315}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By root flooding (PubMed:24363315). Induced by senescence (PubMed:24659488). {ECO:0000269|PubMed:24363315, ECO:0000269|PubMed:24659488}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012458348.1 | 5e-60 | PREDICTED: NAC transcription factor NAM-B1-like | ||||
| Swissprot | Q84TD6 | 3e-51 | NAC47_ARATH; NAC transcription factor 47 | ||||
| TrEMBL | A0A0B0NEF4 | 5e-59 | A0A0B0NEF4_GOSAR; NAC domain-containing 29-like protein | ||||
| TrEMBL | A0A2P5QE04 | 1e-61 | A0A2P5QE04_GOSBA; Uncharacterized protein | ||||
| STRING | Gorai.012G169300.1 | 7e-59 | (Gossypium raimondii) | ||||
| STRING | Gorai.013G191800.1 | 1e-58 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM190 | 28 | 276 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G04070.2 | 1e-53 | NAC domain containing protein 47 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




