PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D04G1749
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 96aa    MW: 11177.7 Da    PI: 9.0721
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D04G1749genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM116.82.2e-36895189
          NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89
                 lppGfrFhPtdeel+ +yL kk++++++++ ++i++vdiyk++PwdLp k+  +ekewyfFs+rd+ky++g r+nrat+ g+Wkatg+d
  Gh_D04G1749  8 LPPGFRFHPTDEELILHYLMKKLSSSPFPV-SIIADVDIYKFDPWDLPDKAVLGEKEWYFFSPRDRKYPNGARPNRATSPGFWKATGRD 95
                 79****************************.89***************7777899********************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-41595IPR003441NAC domain
PROSITE profilePS5100540.392896IPR003441NAC domain
PfamPF023651.7E-16994IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MRHPHSSLPP GFRFHPTDEE LILHYLMKKL SSSPFPVSII ADVDIYKFDP WDLPDKAVLG  60
EKEWYFFSPR DRKYPNGARP NRATSPGFWK ATGRDC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-4379514102Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the promoter of ACO5, an ACC oxidase involved in ethylene biosynthesis. Mediates waterlogging-induced hyponastic leaf movement, and cell expansion in abaxial cells of the basal petiole region, by directly regulating the expression of ACO5 (PubMed:24363315). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:24363315}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By root flooding (PubMed:24363315). Induced by senescence (PubMed:24659488). {ECO:0000269|PubMed:24363315, ECO:0000269|PubMed:24659488}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012458348.15e-60PREDICTED: NAC transcription factor NAM-B1-like
SwissprotQ84TD63e-51NAC47_ARATH; NAC transcription factor 47
TrEMBLA0A0B0NEF45e-59A0A0B0NEF4_GOSAR; NAC domain-containing 29-like protein
TrEMBLA0A2P5QE041e-61A0A2P5QE04_GOSBA; Uncharacterized protein
STRINGGorai.012G169300.17e-59(Gossypium raimondii)
STRINGGorai.013G191800.11e-58(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.21e-53NAC domain containing protein 47
Publications ? help Back to Top
  1. Hofmann NR
    A NAC transcription factor for flooding: SHYG helps plants keep their leaves in the air.
    Plant Cell, 2013. 25(12): p. 4771
    [PMID:24363314]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]