![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gh_D04G1757 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 115aa MW: 13041.1 Da PI: 9.5523 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 118.8 | 5e-37 | 8 | 101 | 1 | 95 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95
+ppGfrFhPtdeel+ +yL kk++++ +++ ++i++vdiy+++PwdLp k+ +ekewyfF++rd+ky++g r+nrat+ g+Wkatg+ k ++++
Gh_D04G1757 8 VPPGFRFHPTDEELILHYLMKKLSSSAFPV-SFIADVDIYQFDPWDLPDKAVLGEKEWYFFCPRDRKYPNGARPNRATRLGFWKATGTVKIIVAS 101
69****************************.89***************7777899*********************************9999885 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 3.53E-41 | 5 | 106 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 38.555 | 8 | 115 | IPR003441 | NAC domain |
| Pfam | PF02365 | 2.4E-17 | 9 | 96 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 115 aa Download sequence Send to blast |
MRHPHSTVPP GFRFHPTDEE LILHYLMKKL SSSAFPVSFI ADVDIYQFDP WDLPDKAVLG 60 EKEWYFFCPR DRKYPNGARP NRATRLGFWK ATGTVKIIVA SSMAAGRGGC ISILV |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 1e-42 | 7 | 106 | 16 | 115 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 1e-42 | 7 | 106 | 16 | 115 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 1e-42 | 7 | 106 | 16 | 115 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 1e-42 | 7 | 106 | 16 | 115 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 1e-42 | 7 | 106 | 19 | 118 | NAC domain-containing protein 19 |
| 3swm_B | 1e-42 | 7 | 106 | 19 | 118 | NAC domain-containing protein 19 |
| 3swm_C | 1e-42 | 7 | 106 | 19 | 118 | NAC domain-containing protein 19 |
| 3swm_D | 1e-42 | 7 | 106 | 19 | 118 | NAC domain-containing protein 19 |
| 3swp_A | 1e-42 | 7 | 106 | 19 | 118 | NAC domain-containing protein 19 |
| 3swp_B | 1e-42 | 7 | 106 | 19 | 118 | NAC domain-containing protein 19 |
| 3swp_C | 1e-42 | 7 | 106 | 19 | 118 | NAC domain-containing protein 19 |
| 3swp_D | 1e-42 | 7 | 106 | 19 | 118 | NAC domain-containing protein 19 |
| 4dul_A | 1e-42 | 7 | 106 | 16 | 115 | NAC domain-containing protein 19 |
| 4dul_B | 1e-42 | 7 | 106 | 16 | 115 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds to the promoter of ACO5, an ACC oxidase involved in ethylene biosynthesis. Mediates waterlogging-induced hyponastic leaf movement, and cell expansion in abaxial cells of the basal petiole region, by directly regulating the expression of ACO5 (PubMed:24363315). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:24363315}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By root flooding (PubMed:24363315). Induced by senescence (PubMed:24659488). {ECO:0000269|PubMed:24363315, ECO:0000269|PubMed:24659488}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012458348.1 | 2e-80 | PREDICTED: NAC transcription factor NAM-B1-like | ||||
| Swissprot | Q84TD6 | 2e-50 | NAC47_ARATH; NAC transcription factor 47 | ||||
| TrEMBL | A0A2P5QKW5 | 8e-81 | A0A2P5QKW5_GOSBA; Uncharacterized protein | ||||
| STRING | Gorai.012G169300.1 | 7e-66 | (Gossypium raimondii) | ||||
| STRING | Gorai.013G191800.1 | 9e-66 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM190 | 28 | 276 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G04070.1 | 6e-53 | NAC domain containing protein 47 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




