PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_D05G0393

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

MYB

Protein Properties

Length: 199aa MW: 23123.1 Da PI: 8.6193

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_D05G0393	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	66.7	4.2e-21	17	64	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd++l+++v+ +G+++Wk++a++ g++R++k+c++rw +yl Gh_D05G0393 17 RGAWTAEEDQKLAQVVEIHGPKRWKAVAAKAGLNRCGKSCRLRWMNYL 64 89********************************************97 PP
2	Myb_DNA-binding	50.8	3.9e-16	70	115	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l Gh_D05G0393 70 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 115 78999***************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	27.575	12	68	IPR017930	Myb domain
SuperFamily	SSF46689	2.27E-30	15	111	IPR009057	Homeodomain-like
SMART	SM00717	2.4E-17	16	66	IPR001005	SANT/Myb domain
Pfam	PF00249	4.6E-20	17	64	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.9E-25	18	71	IPR009057	Homeodomain-like
CDD	cd00167	8.77E-12	19	64	No hit	No description
SMART	SM00717	1.9E-15	69	117	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	20.918	69	119	IPR017930	Myb domain
Pfam	PF00249	1.6E-14	70	115	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.8E-25	72	120	IPR009057	Homeodomain-like
CDD	cd00167	1.22E-9	74	115	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 199 aa Download sequence Send to blast
MSMAPTSTKC SKKEVNRGAW TAEEDQKLAQ VVEIHGPKRW KAVAAKAGLN RCGKSCRLRW 60 MNYLRPNIKR GNISDQEEDL ILRLHKLLGN RWSLIAGRLP GRTDNEIKNY WNSHLSKKIK 120 QNEKQTRMQE PVLENSKVSE REEPLHKASE EGSSKRDEEY STSCFNGDSS LFDLYNKEPL 180 ELEWMSHFFE TDEVWLNLA

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	4e-31	14	119	1	105	MYB PROTO-ONCOGENE PROTEIN
1h8a_C	9e-31	14	119	24	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Siliques. {ECO:0000269\|PubMed:9839469}.

Functional Description ? help Back to Top
Source	Description
UniProt	Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor.
UniProt	Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1 or BHLH042/TT8. {ECO:0000269\|PubMed:15361138}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JX582297	2e-68	JX582297.1 Gossypium hirsutum clone NBRI_GE15106 microsatellite sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016753002.1	1e-145	PREDICTED: transcription factor MYB114-like
Refseq	XP_017646585.1	1e-145	PREDICTED: transcription factor MYB114-like
Swissprot	P10290	9e-53	MYBC_MAIZE; Anthocyanin regulatory C1 protein
Swissprot	Q38850	4e-53	MYB5_ARATH; Transcription repressor MYB5
TrEMBL	A0A1U8PPB7	1e-144	A0A1U8PPB7_GOSHI; transcription factor MYB114-like
TrEMBL	A0A2P5WPG5	1e-144	A0A2P5WPG5_GOSBA; Uncharacterized protein
STRING	Gorai.009G040800.1	1e-144	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G13540.1	2e-55	myb domain protein 5

Publications ? help Back to Top
Chen B,Wang X,Hu Y,Wang Y,Lin Z Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco. Mol. Biotechnol., 2004. 26(3): p. 187-92 [PMID:15004287] Paz-Ares J,Ghosal D,Saedler H Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus. EMBO J., 1990. 9(2): p. 315-21 [PMID:2303027] Ranocha P,Francoz E,Burlat V,Dunand C Expression of PRX36, PMEI6 and SBT1.7 is controlled by complex transcription factor regulatory networks for proper seed coat mucilage extrusion. Plant Signal Behav, 2014. 9(11): p. e977734 [PMID:25531128] Cone KC,Burr FA,Burr B Molecular analysis of the maize anthocyanin regulatory locus C1. Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5 [PMID:3025847] Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators. EMBO J., 1987. 6(12): p. 3553-8 [PMID:3428265] Scheffler B, et al. Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene. Mol. Gen. Genet., 1994. 242(1): p. 40-8 [PMID:7904044] Franken P,Schrell S,Peterson PA,Saedler H,Wienand U Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38. Plant J., 1994. 6(1): p. 21-30 [PMID:7920701] Singer T,Gierl A,Peterson PA Three new dominant C1 suppressor alleles in Zea mays. Genet. Res., 1998. 71(2): p. 127-32 [PMID:9717435]