PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_D05G0394

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

MYB

Protein Properties

Length: 188aa MW: 21754.5 Da PI: 8.3173

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_D05G0394	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	62.4	8.9e-20	18	65	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEd++l+++v+ +G+++W ++a++ g++R++k+c++rw +yl Gh_D05G0394 18 RGAWTDEEDQKLAQVVEIYGPKRWQAVAAKAGLNRSGKSCRLRWMNYL 65 89********************************************97 PP
2	Myb_DNA-binding	50.9	3.5e-16	71	116	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l Gh_D05G0394 71 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 116 78999***************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	27.055	13	69	IPR017930	Myb domain
SuperFamily	SSF46689	4.77E-30	16	112	IPR009057	Homeodomain-like
SMART	SM00717	2.2E-17	17	67	IPR001005	SANT/Myb domain
Pfam	PF00249	3.5E-19	18	65	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.2E-24	19	72	IPR009057	Homeodomain-like
CDD	cd00167	3.10E-12	20	65	No hit	No description
SMART	SM00717	1.9E-15	70	118	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	20.215	70	120	IPR017930	Myb domain
Pfam	PF00249	1.5E-14	71	116	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	5.5E-25	73	119	IPR009057	Homeodomain-like
CDD	cd00167	3.48E-10	75	116	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 188 aa Download sequence Send to blast
MPVAPPISTK CSKKEVNRGA WTDEEDQKLA QVVEIYGPKR WQAVAAKAGL NRSGKSCRLR 60 WMNYLRPNIK RGNISDQEED LILRLHKLLG NRWSLIAGRL PGRTDNEIKN YWNSHLSKKT 120 KQNEKQTIGS RMQEPVLENC KVSESKRDEN STACFINGDD SLFDSYSEEP LNLEWTSHFF 180 ETDELWLN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	2e-31	15	120	1	105	MYB PROTO-ONCOGENE PROTEIN
1h8a_C	3e-31	15	120	24	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JX582297	3e-48	JX582297.1 Gossypium hirsutum clone NBRI_GE15106 microsatellite sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016684430.1	1e-139	PREDICTED: transcription factor MYB114-like
Swissprot	P10290	4e-50	MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBL	A0A1U8J277	1e-137	A0A1U8J277_GOSHI; transcription factor MYB114-like
STRING	Gorai.009G040900.1	1e-137	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G13540.1	2e-52	myb domain protein 5

Publications ? help Back to Top
Chen B,Wang X,Hu Y,Wang Y,Lin Z Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco. Mol. Biotechnol., 2004. 26(3): p. 187-92 [PMID:15004287] Paz-Ares J,Ghosal D,Saedler H Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus. EMBO J., 1990. 9(2): p. 315-21 [PMID:2303027] Cone KC,Burr FA,Burr B Molecular analysis of the maize anthocyanin regulatory locus C1. Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5 [PMID:3025847] Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators. EMBO J., 1987. 6(12): p. 3553-8 [PMID:3428265] Scheffler B, et al. Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene. Mol. Gen. Genet., 1994. 242(1): p. 40-8 [PMID:7904044] Franken P,Schrell S,Peterson PA,Saedler H,Wienand U Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38. Plant J., 1994. 6(1): p. 21-30 [PMID:7920701] Singer T,Gierl A,Peterson PA Three new dominant C1 suppressor alleles in Zea mays. Genet. Res., 1998. 71(2): p. 127-32 [PMID:9717435]