PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_D06G0886

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

MYB

Protein Properties

Length: 205aa MW: 23651.7 Da PI: 8.7933

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_D06G0886	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	63.6	4e-20	17	64	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd++l++++ ++G+++Wk+Ia++ g++R++k+c++rw +yl Gh_D06G0886 17 RGAWTAEEDQKLAQVIDLHGPKRWKSIAAKAGLKRSGKSCRLRWMNYL 64 89********************************************97 PP
2	Myb_DNA-binding	51.6	2.1e-16	70	115	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+ + +E++l+++++k+lG++ W++Ia +++ gRt++q+k++w+++l Gh_D06G0886 70 KGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNQIKNYWNSHL 115 68889***************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	26.806	12	68	IPR017930	Myb domain
SuperFamily	SSF46689	9.36E-30	15	111	IPR009057	Homeodomain-like
SMART	SM00717	1.1E-16	16	66	IPR001005	SANT/Myb domain
Pfam	PF00249	3.2E-19	17	64	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	8.7E-25	18	71	IPR009057	Homeodomain-like
CDD	cd00167	3.39E-12	19	64	No hit	No description
SMART	SM00717	7.2E-16	69	117	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	22.016	69	119	IPR017930	Myb domain
Pfam	PF00249	6.4E-15	70	115	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	8.4E-26	72	119	IPR009057	Homeodomain-like
CDD	cd00167	1.60E-10	74	115	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 205 aa Download sequence Send to blast
MAMAPVTTKC NLKEVNRGAW TAEEDQKLAQ VIDLHGPKRW KSIAAKAGLK RSGKSCRLRW 60 MNYLRPNIKK GNISDQEEDL ILRLHKLLGN RWSLIAGRLP GRTDNQIKNY WNSHLSKKIK 120 LNENRNKGSE IQEPVLDNSK GNETVFLPKG SEEGTSKRDD DYNSTPCLFG DTMSDFHSAE 180 ALNWEWMSQF FEINESWDYF AYDII

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	8e-31	14	119	24	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Restricted to roots and hypocotyl. Specifically expressed in root non-hair developing cells (atrichoblasts) at the N position. Also present in lateral root cap cells. In hypocotyls, expressed within files of epidermal cells located outside a single cortical cell equivalent to roots N cells (at protein level). {ECO:0000269\|PubMed:10589676, ECO:0000269\|PubMed:14627722, ECO:0000269\|PubMed:16207757}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269\|PubMed:10589676, ECO:0000269\|PubMed:11585796, ECO:0000269\|PubMed:14627722, ECO:0000269\|PubMed:15361138, ECO:0000269\|PubMed:15795220, ECO:0000269\|PubMed:16207757}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269\|PubMed:11910008, ECO:0000269\|PubMed:16176989}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY115511	2e-52	AY115511.1 Gossypioides kirkii myb-like transcription factor 3 (MYB3) gene, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016682318.1	1e-152	PREDICTED: transcription factor MYB114-like
Swissprot	Q9SEI0	6e-51	WER_ARATH; Transcription factor WER
TrEMBL	A0A1U8J161	1e-151	A0A1U8J161_GOSHI; transcription factor MYB114-like
STRING	Gorai.010G096800.1	1e-151	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G14750.1	3e-53	myb domain protein 66

Publications ? help Back to Top
Savage N, et al. Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana. PLoS ONE, 2013. 8(10): p. e75452 [PMID:24130712] Cheng Y, et al. Brassinosteroids control root epidermal cell fate via direct regulation of a MYB-bHLH-WD40 complex by GSK3-like kinases. Elife, 2018. [PMID:24771765] Kiefer CS, et al. Correction: Arabidopsis AIP1-2 restricted by WER-mediated patterning modulates planar polarity. Development, 2015. 142(5): p. 1022 [PMID:25715402] Kwak SH,Song SK,Lee MM,Schiefelbein J TORNADO1 regulates root epidermal patterning through the WEREWOLF pathway in Arabidopsis thaliana. Plant Signal Behav, 2015. 10(12): p. e1103407 [PMID:26451798] Zhu Y, et al. The Histone Chaperone NRP1 Interacts with WEREWOLF to Activate GLABRA2 in Arabidopsis Root Hair Development. Plant Cell, 2017. 29(2): p. 260-276 [PMID:28138017] Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana. Plant J., 2017. 92(2): p. 305-316 [PMID:28771873] Mira MM, et al. Expression of Arabidopsis class 1 phytoglobin (AtPgb1) delays death and degradation of the root apical meristem during severe PEG-induced water deficit. J. Exp. Bot., 2017. 68(20): p. 5653-5668 [PMID:29059380] Kohanová J, et al. Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots. Ann. Bot., 2018. 122(5): p. 903-914 [PMID:29394308]