PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_D06G2159

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

VOZ

Protein Properties

Length: 101aa MW: 11646.3 Da PI: 9.4132

Description

VOZ family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_D06G2159	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	VOZ	101.1	1.4e-31	22	89	138	205
VOZ 138 hesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksakgkvskdsl 205 srkqvm+ef+glkrsyymdpq ++ f+wh yeyein++da+alyrle klvd+kksakg ++d+ Gh_D06G2159 22 CMSRKQVMNEFEGLKRSYYMDPQTLNRFKWHYYEYEINKCDACALYRLESKLVDGKKSAKGISANDTD 89 569**********************************************************8888765 PP

Sequence ? help Back to Top
Protein Sequence Length: 101 aa Download sequence Send to blast
MNLVRKREQK TGLSQITTAV VCMSRKQVMN EFEGLKRSYY MDPQTLNRFK WHYYEYEINK 60 CDACALYRLE SKLVDGKKSA KGISANDTDT DGKTHGGVPM Q

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Ghi.3487	4e-56	boll\| ovule

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles of various tissues, specifically in the phloem. {ECO:0000269\|PubMed:15295067, ECO:0000269\|PubMed:22904146}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269\|PubMed:15295067, ECO:0000269\|PubMed:22904146}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By far-red light. {ECO:0000269\|PubMed:22904146}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012444209.1	9e-34	PREDICTED: transcription factor VOZ1-like isoform X1
Refseq	XP_012444210.1	9e-34	PREDICTED: transcription factor VOZ1-like isoform X1
Refseq	XP_012444211.1	9e-34	PREDICTED: transcription factor VOZ1-like isoform X1
Refseq	XP_012444212.1	9e-34	PREDICTED: transcription factor VOZ1-like isoform X2
Refseq	XP_012444213.1	9e-34	PREDICTED: transcription factor VOZ1-like isoform X2
Refseq	XP_016730807.1	9e-34	PREDICTED: transcription factor VOZ1
Refseq	XP_016730808.1	9e-34	PREDICTED: transcription factor VOZ1
Refseq	XP_016730809.1	9e-34	PREDICTED: transcription factor VOZ1
Swissprot	Q9SGQ0	3e-30	VOZ1_ARATH; Transcription factor VOZ1
TrEMBL	A0A0D2V9E4	2e-68	A0A0D2V9E4_GOSRA; Uncharacterized protein
STRING	Gorai.010G243300.1	4e-69	(Gossypium raimondii)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G28520.2	1e-32	vascular plant one zinc finger protein

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Yasui Y,Kohchi T VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis. Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5 [PMID:25351333] Kumar S,Choudhary P,Gupta M,Nath U VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition. Plant Physiol., 2018. 176(4): p. 2917-2930 [PMID:29507119] Song C,Lee J,Kim T,Hong JC,Lim CO VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis. Planta, 2018. 247(6): p. 1439-1448 [PMID:29536220]