![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gh_D06G2201 | ||||||||
| Common Name | CPC | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 79aa MW: 9142.88 Da PI: 4.1393 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 38.8 | 2.1e-12 | 30 | 73 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
+++++++E+ l+++ +++ G + W++Ia +++ gRt++++ ++w++
Gh_D06G2201 30 KLKFSEDEETLIIRMFNLVGER-WALIAGRIP-GRTAEEIEEYWNT 73
689*******************.*********.***********96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 13.836 | 25 | 79 | IPR017930 | Myb domain |
| SMART | SM00717 | 3.6E-10 | 29 | 77 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.1E-11 | 31 | 73 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 3.89E-9 | 32 | 73 | No hit | No description |
| SuperFamily | SSF46689 | 1.95E-9 | 32 | 75 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 1.7E-14 | 32 | 74 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 79 aa Download sequence Send to blast |
MADSQHSSSG KTYVNSQDFS SEEETNEESK LKFSEDEETL IIRMFNLVGE RWALIAGRIP 60 GRTAEEIEEY WNTRYSTSE |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Ghi.115 | 1e-130 | boll| ovule | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed in leaves primordia and later confined to trichomes. {ECO:0000269|PubMed:12356720}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in trichomes and in young developing leaves, as well as in root hair and stele cells (pericycle and vascular tissues). Expressed in epidermal root hairless cells (atrichoblasts) and moves to root hair cells (trichoblasts) by a cell-to-cell movement through plasmodesmata (at protein level). {ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16291794}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Determines the fate of epidermal cell differentiation. Represses trichome development by lateral inhibition. Together with GL3 or BHLH2, promotes the formation of hair developing cells (H position) in root epidermis, probably by inhibiting non-hair cell formation. Represses the expression of GL2 and WER in H cells. Positively regulates stomatal formation in the hypocotyl (PubMed:19513241). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:12356720, ECO:0000269|PubMed:16291794, ECO:0000269|PubMed:19513241, ECO:0000269|PubMed:9262483}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Transcriptional repression correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in root epidermis N cells (non-hair developing cells). Induced by WER. Negative autoregulation by interfering with the binding of WER to its WER-binding sites (WBS) promoter region, especially in H cells. Down-regulated by GEM. Down-regulated by TMM (PubMed:19513241). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16176989, ECO:0000269|PubMed:16207757, ECO:0000269|PubMed:17450124, ECO:0000269|PubMed:19513241}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FJ402930 | 1e-131 | FJ402930.1 Gossypium hirsutum cultivar TM-1 CAPRICE (CPC) mRNA, complete cds. | |||
| GenBank | FJ402932 | 1e-131 | FJ402932.1 Gossypium hirsutum cultivar MD17 CAPRICE (CPC) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012450325.1 | 2e-51 | PREDICTED: MYB-like transcription factor ETC1 | ||||
| Refseq | XP_016751956.1 | 2e-51 | PREDICTED: MYB-like transcription factor ETC1 | ||||
| Swissprot | O22059 | 1e-15 | CPC_ARATH; Transcription factor CPC | ||||
| TrEMBL | A0A2P5RF68 | 4e-50 | A0A2P5RF68_GOSBA; Uncharacterized protein | ||||
| TrEMBL | B7TX25 | 4e-50 | B7TX25_GOSHI; CAPRICE | ||||
| TrEMBL | B7TX33 | 4e-50 | B7TX33_GOSRA; CAPRICE | ||||
| TrEMBL | B7TX34 | 4e-50 | B7TX34_GOSHE; CAPRICE | ||||
| STRING | Gorai.010G253000.1 | 7e-51 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM323 | 28 | 194 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G46410.1 | 4e-18 | MYB_related family protein | ||||




