![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gh_D08G0905 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | HD-ZIP | ||||||||
| Protein Properties | Length: 130aa MW: 14860.8 Da PI: 7.3506 | ||||||||
| Description | HD-ZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 61.4 | 1.4e-19 | 20 | 73 | 3 | 56 |
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
k+++++ +q+++Le+ F +++ e++ +LA++lgL+ rqV +WFqNrRa++k
Gh_D08G0905 20 KKRRLSMHQVKALEKNFDVGNKLEPERKVKLAEELGLQPRQVAIWFQNRRARWK 73
56689************************************************9 PP
| |||||||
| 2 | HD-ZIP_I/II | 113.1 | 1.8e-36 | 19 | 90 | 1 | 72 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkrayda 72
ekkrrls +qvk+LE++F+ +kLeperKv+la+eLglqprqva+WFqnrRAR+ktk lEkdy++Lk++ ++
Gh_D08G0905 19 EKKRRLSMHQVKALEKNFDVGNKLEPERKVKLAEELGLQPRQVAIWFQNRRARWKTKVLEKDYAMLKANREK 90
69*****************************************************************99876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 2.95E-19 | 13 | 75 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50071 | 17.475 | 15 | 75 | IPR001356 | Homeobox domain |
| SMART | SM00389 | 4.6E-18 | 18 | 79 | IPR001356 | Homeobox domain |
| Pfam | PF00046 | 8.0E-17 | 20 | 73 | IPR001356 | Homeobox domain |
| CDD | cd00086 | 3.83E-16 | 20 | 75 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 9.2E-20 | 27 | 74 | IPR009057 | Homeodomain-like |
| PRINTS | PR00031 | 2.5E-6 | 46 | 55 | IPR000047 | Helix-turn-helix motif |
| PROSITE pattern | PS00027 | 0 | 50 | 73 | IPR017970 | Homeobox, conserved site |
| PRINTS | PR00031 | 2.5E-6 | 55 | 71 | IPR000047 | Helix-turn-helix motif |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 130 aa Download sequence Send to blast |
MLDGLDEEDS LEEGGQATEK KRRLSMHQVK ALEKNFDVGN KLEPERKVKL AEELGLQPRQ 60 VAIWFQNRRA RWKTKVLEKD YAMLKANREK EPPRNCSDCL HSPSDNRQLS GDDCPLVPPK 120 SSLEMTVNGS |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Localized primarily to the hypocotyl of germinating seedlings. {ECO:0000269|PubMed:12678559}. | |||||
| Uniprot | TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that acts as a positive regulator of ABA-responsiveness, mediating the inhibitory effect of ABA on growth during seedling establishment. Binds to the DNA sequence 5'-CAATNATTG-3'. {ECO:0000269|PubMed:12678559}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Down-regulated by abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:12678559, ECO:0000269|PubMed:16055682}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC243121 | 1e-144 | AC243121.1 Gossypium raimondii clone GR__Ba0142D21-hnv, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012474465.1 | 7e-89 | PREDICTED: homeobox-leucine zipper protein ATHB-6-like isoform X1 | ||||
| Refseq | XP_012474467.1 | 7e-89 | PREDICTED: homeobox-leucine zipper protein ATHB-6-like isoform X1 | ||||
| Refseq | XP_012474468.1 | 7e-89 | PREDICTED: homeobox-leucine zipper protein ATHB-6-like isoform X1 | ||||
| Refseq | XP_016696668.1 | 2e-89 | PREDICTED: homeobox-leucine zipper protein ATHB-5-like | ||||
| Swissprot | P46667 | 1e-36 | ATHB5_ARATH; Homeobox-leucine zipper protein ATHB-5 | ||||
| TrEMBL | A0A2P5R802 | 6e-89 | A0A2P5R802_GOSBA; Uncharacterized protein | ||||
| STRING | Gorai.006G273000.1 | 2e-89 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM545 | 28 | 143 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G65310.1 | 1e-36 | homeobox protein 5 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




