![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gh_D12G1645 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | bHLH | ||||||||
| Protein Properties | Length: 92aa MW: 10354.7 Da PI: 10.1049 | ||||||||
| Description | bHLH family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HLH | 23 | 1.4e-07 | 20 | 59 | 15 | 54 |
HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
+i + ++L++l+P++ + + K+s + +L+++++YI+sL
Gh_D12G1645 20 QIIDLVSKLQQLIPELRGRRPDKVSASKVLQETCNYIRSL 59
5667779********8677777888899**********99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50888 | 10.442 | 5 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene3D | G3DSA:4.10.280.10 | 2.7E-8 | 19 | 73 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Pfam | PF00010 | 5.0E-5 | 20 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| SuperFamily | SSF47459 | 3.01E-8 | 20 | 76 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 92 aa Download sequence Send to blast |
MSSRRSRSRQ SGASRITDDQ IIDLVSKLQQ LIPELRGRRP DKVSASKVLQ ETCNYIRSLH 60 REVDGLSDRL SQLLASTDTD SDQAAIIRSL LM |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. May have a regulatory role in various aspects of gibberellin-dependent growth and development. {ECO:0000269|PubMed:16527868}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012435728.1 | 6e-58 | PREDICTED: transcription factor PRE6-like | ||||
| Refseq | XP_016737688.1 | 6e-58 | PREDICTED: transcription factor PRE6-like | ||||
| Swissprot | Q9LJX1 | 1e-39 | PRE5_ARATH; Transcription factor PRE5 | ||||
| TrEMBL | A0A0D2U5B0 | 1e-56 | A0A0D2U5B0_GOSRA; Uncharacterized protein | ||||
| TrEMBL | A0A1U8NI60 | 1e-56 | A0A1U8NI60_GOSHI; transcription factor PRE6-like | ||||
| TrEMBL | A0A2P5Q5P4 | 1e-56 | A0A2P5Q5P4_GOSBA; Uncharacterized protein | ||||
| STRING | Gorai.008G181800.1 | 2e-57 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM259 | 28 | 225 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G26945.1 | 9e-39 | bHLH family protein | ||||




