PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_Sca034539G01

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

Dof

Protein Properties

Length: 88aa MW: 10092.5 Da PI: 9.3536

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_Sca034539G01	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	107.2	8.6e-34	40	88	2	50
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvP 50 ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvP Gh_Sca034539G01 40 PDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVP 88 68999*******************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	2.0E-25	39	88	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	5.3E-28	42	88	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	26.152	44	88	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	46	82	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MASHEGQGIK LFGATITLHA GRQVKEEHKE DDHSKADKRP DKIIPCPRCK SMETKFCYFN 60 NYNVNQPRHF CKGCQRYWTA GGALRNVP

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269\|PubMed:19619493}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269\|PubMed:19619493}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JX616238	2e-44	JX616238.1 Gossypium hirsutum clone NBRI_GE60732 microsatellite sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012445710.1	6e-62	PREDICTED: dof zinc finger protein DOF1.5-like
Refseq	XP_016688063.1	6e-62	PREDICTED: dof zinc finger protein DOF1.5-like
Swissprot	P68350	2e-40	DOF15_ARATH; Dof zinc finger protein DOF1.5
TrEMBL	A0A0D2S2B8	1e-60	A0A0D2S2B8_GOSRA; Uncharacterized protein
TrEMBL	A0A1U8JHD1	1e-60	A0A1U8JHD1_GOSHI; dof zinc finger protein DOF1.5-like
TrEMBL	A0A2P5X6S3	1e-60	A0A2P5X6S3_GOSBA; Uncharacterized protein
STRING	Gorai.009G162500.1	2e-61	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2809	26	69

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G29160.1	1e-42	Dof family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Bueso E, et al. Arabidopsis COGWHEEL1 links light perception and gibberellins with seed tolerance to deterioration. Plant J., 2016. 87(6): p. 583-96 [PMID:27227784]