PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_Sca072684G01

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

MYB

Protein Properties

Length: 137aa MW: 15782.1 Da PI: 9.8833

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_Sca072684G01	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	54.7	2.3e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+ +++ +G g+W++ ++ g+ R++k+c++rw +yl Gh_Sca072684G01 14 KGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61 79****************************99**********97 PP
2	Myb_DNA-binding	61.7	1.5e-19	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T+eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++ Gh_Sca072684G01 67 RGNFTEEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111 89******************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.1E-24	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	16.723	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	2.01E-30	13	108	IPR009057	Homeodomain-like
SMART	SM00717	1.9E-13	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.3E-15	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	5.88E-10	16	61	No hit	No description
PROSITE profile	PS51294	29.411	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	8.3E-29	65	116	IPR009057	Homeodomain-like
SMART	SM00717	6.3E-18	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	1.0E-17	67	111	IPR001005	SANT/Myb domain
CDD	cd00167	1.68E-12	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 137 aa Download sequence Send to blast
MGRSPCCEKA HTNKGAWTKE EDDRLIAYIR AHGEGCWRSL PKAAGLLRCG KSCRLRWINY 60 LRPDLKRGNF TEEEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIRRKLLNRG 120 IDPATHRPLS EAGVHQD

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	1e-30	13	116	26	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Ghi.14333	0.0	boll

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Widely expressed at low level. Highly expressed in siliques. Weakly expressed in seedlings, young and mature leaves, cauline leaves, stems, flower buds and roots. {ECO:0000269\|PubMed:9839469}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HQ234875	0.0	HQ234875.1 Gossypium hirsutum MYB transcription factor mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017634926.1	5e-98	PREDICTED: myb-related protein 308-like
Swissprot	Q9SZP1	1e-92	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	A0A0B0MKK2	3e-97	A0A0B0MKK2_GOSAR; Myb-related protein
TrEMBL	A0A1U8LZX6	1e-96	A0A1U8LZX6_GOSHI; myb-related protein 308-like
TrEMBL	A0A2P5YQF4	1e-96	A0A2P5YQF4_GOSBA; Uncharacterized protein
STRING	Gorai.008G035700.1	8e-97	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38620.1	6e-95	myb domain protein 4

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]