PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_Sca077544G01

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

NAC

Protein Properties

Length: 92aa MW: 10506.9 Da PI: 10.8511

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_Sca077544G01	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	84.7	1.8e-26	7	79	55	128
NAM 55 ekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +ewyfF++rd+k+++gkr+nra+ +g+Wka +dk+v+s +g+l+glkktLv+ +g+ +k++kt+W++hey l Gh_Sca077544G01 7 INEWYFFTSRDRKHPQGKRPNRAAGDGFWKAVNSDKHVKS-NGKLIGLKKTLVYCRGKPSKAQKTNWIVHEYVL 79 469***********************************.99***************************87 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	29.481	1	92	IPR003441	NAC domain
SuperFamily	SSF101941	2.09E-28	8	84	IPR003441	NAC domain
Pfam	PF02365	9.6E-13	10	79	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 92 aa Download sequence Send to blast
MSSNGTINEW YFFTSRDRKH PQGKRPNRAA GDGFWKAVNS DKHVKSNGKL IGLKKTLVYC 60 RGKPSKAQKT NWIVHEYVLS DPPQTTHKNG HQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-26	9	90	72	150	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-26	9	90	72	150	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-26	9	90	72	150	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-26	9	90	72	150	NO APICAL MERISTEM PROTEIN
3swm_A	1e-26	9	90	75	153	NAC domain-containing protein 19
3swm_B	1e-26	9	90	75	153	NAC domain-containing protein 19
3swm_C	1e-26	9	90	75	153	NAC domain-containing protein 19
3swm_D	1e-26	9	90	75	153	NAC domain-containing protein 19
3swp_A	1e-26	9	90	75	153	NAC domain-containing protein 19
3swp_B	1e-26	9	90	75	153	NAC domain-containing protein 19
3swp_C	1e-26	9	90	75	153	NAC domain-containing protein 19
3swp_D	1e-26	9	90	75	153	NAC domain-containing protein 19
4dul_A	1e-26	9	90	72	150	NAC domain-containing protein 19
4dul_B	1e-26	9	90	72	150	NAC domain-containing protein 19
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in roots, stem, flowers, and leaves. {ECO:0000269\|PubMed:29760199}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence and reduces fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. {ECO:0000269\|PubMed:29760199}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. {ECO:0000269\|PubMed:29760199}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016747821.1	5e-64	PREDICTED: NAC domain-containing protein 68-like
Swissprot	K4BWV2	6e-28	NAP1_SOLLC; NAC domain-containing protein 1
TrEMBL	A0A1U8P9E7	1e-62	A0A1U8P9E7_GOSHI; NAC domain-containing protein 68-like
STRING	Gorai.012G073400.1	5e-62	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM21958	4	5

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G15500.1	7e-28	NAC domain containing protein 3

Publications ? help Back to Top
Tomato Genome Consortium The tomato genome sequence provides insights into fleshy fruit evolution. Nature, 2012. 485(7400): p. 635-41 [PMID:22660326] Ma X, et al. The NAC Transcription Factor SlNAP2 Regulates Leaf Senescence and Fruit Yield in Tomato. Plant Physiol., 2018. 177(3): p. 1286-1302 [PMID:29760199]