![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gh_Sca082239G01 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 143aa MW: 15694.2 Da PI: 10.9667 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 57.1 | 2.5e-18 | 76 | 110 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C +C t kTp+WR gp g+ktLCnaCG++y++ +l
Gh_Sca082239G01 76 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 110
99*****************************9885 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00401 | 6.9E-17 | 70 | 120 | IPR000679 | Zinc finger, GATA-type |
| PROSITE profile | PS50114 | 12.545 | 70 | 106 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 4.1E-15 | 71 | 108 | IPR013088 | Zinc finger, NHR/GATA-type |
| SuperFamily | SSF57716 | 3.52E-16 | 72 | 134 | No hit | No description |
| CDD | cd00202 | 1.66E-12 | 75 | 122 | No hit | No description |
| Pfam | PF00320 | 3.2E-16 | 76 | 110 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 76 | 101 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 143 aa Download sequence Send to blast |
MTVPAKARSK RSRAAPCNWA SRLLVLSPTV SSPEPDIIVP VQPLPSNQPG KKPVKTTSSS 60 SKKKDCGETS SDGRKCLHCA TDKTPQWRTG PMGPKTLCNA CGVRYKSGRL VPEYRPAASP 120 TFVLTKHSNS HRKVLELRRQ KEM |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in the vascular cylinder of roots. Expressed in the differentiation zone of the root stele. {ECO:0000269|PubMed:25265867}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). Transcription activator involved in xylem formation. Functions upstream of NAC030/VND7, a master switch of xylem vessel differentiation (PubMed:25265867). {ECO:0000250|UniProtKB:Q8LAU9, ECO:0000269|PubMed:25265867}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HQ524465 | 0.0 | HQ524465.1 Gossypium herbaceum clone NBRI_G035 simple sequence repeat marker, genomic sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017625306.1 | 2e-98 | PREDICTED: GATA transcription factor 12-like | ||||
| Swissprot | P69781 | 3e-57 | GAT12_ARATH; GATA transcription factor 12 | ||||
| TrEMBL | A0A0B0NEF8 | 4e-97 | A0A0B0NEF8_GOSAR; GATA transcription factor | ||||
| STRING | Gorai.004G288400.1 | 7e-98 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM5682 | 27 | 49 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G32890.1 | 8e-49 | GATA transcription factor 9 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




