PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_Sca085262G01

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

NAC

Protein Properties

Length: 88aa MW: 10871.5 Da PI: 9.3682

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_Sca085262G01	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	93.3	4e-29	14	88	1	76
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknr 76 + pGfrFhPtdeelv +yLk+kv++++ ++ e+ik++diyk++PwdLpk+++++ekewyf+++rd+ky+++ r+nr Gh_Sca085262G01 14 MLPGFRFHPTDEELVGFYLKRKVQQRPPSM-EFIKQLDIYKYDPWDLPKMATTGEKEWYFYCPRDRKYRNSARPNR 88 579**********************999.99***********9888999*****************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	4.97E-30	12	88	IPR003441	NAC domain
PROSITE profile	PS51005	30.237	14	88	IPR003441	NAC domain
Pfam	PF02365	3.8E-13	16	81	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MKERSESDKM EEIMLPGFRF HPTDEELVGF YLKRKVQQRP PSMEFIKQLD IYKYDPWDLP 60 KMATTGEKEW YFYCPRDRKY RNSARPNR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	3e-27	1	88	1	89	Stress-induced transcription factor NAC1
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: First expressed at globular stage onward in the COL progenitors after the first division of the hypophyseal cell. Later observed in these cells and their descendants, mostly in direct daughter cells. Also detected in the Epi/LRC stem cells and daughters, and is retained in maturing LRC layers. Present in elongated stem cells that are about to divide. {ECO:0000269\|PubMed:19081078}.
Uniprot	TISSUE SPECIFICITY: Expressed in root cap stem cells and their immediate daughters. {ECO:0000269\|PubMed:19081078}.

Functional Description ? help Back to Top
Source	Description
UniProt	Promotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269\|PubMed:19081078}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269\|PubMed:19081078}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KC847236	1e-143	KC847236.1 Gossypium hirsutum NAC domain protein NAC59 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017618860.1	6e-59	PREDICTED: transcription factor JUNGBRUNNEN 1-like
Swissprot	Q9ZVH0	3e-45	FEZ_ARATH; Protein FEZ
TrEMBL	A0A0D2SAQ4	1e-57	A0A0D2SAQ4_GOSRA; Uncharacterized protein
TrEMBL	A0A1U8KU62	1e-57	A0A1U8KU62_GOSHI; protein FEZ-like
TrEMBL	A0A1U8P8T7	1e-57	A0A1U8P8T7_GOSHI; transcription factor JUNGBRUNNEN 1-like
TrEMBL	W6J8T2	1e-57	W6J8T2_GOSHI; NAC domain protein NAC59
STRING	Gorai.013G085000.1	2e-58	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM306	28	200

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G26870.1	1e-47	NAC family protein

Publications ? help Back to Top
Bennett T,van den Toorn A,Willemsen V,Scheres B Precise control of plant stem cell activity through parallel regulatory inputs. Development, 2014. 141(21): p. 4055-64 [PMID:25256342]