![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gh_Sca088565G01 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 85aa MW: 9544.75 Da PI: 4.106 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 42.3 | 1.8e-13 | 38 | 80 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
g+WT +E +ll++a +++ + W+ Ia+++ ++t qc++++++
Gh_Sca088565G01 38 GKWTDQETLLLLEALELYKEN-WNEIAEHVA-TKTKAQCILHFLQ 80
89*****************88.*********.**********986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 4.3E-10 | 34 | 78 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51293 | 23.007 | 35 | 85 | IPR017884 | SANT domain |
| SuperFamily | SSF46689 | 6.36E-14 | 35 | 84 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.5E-12 | 36 | 84 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.5E-13 | 38 | 81 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 3.12E-5 | 56 | 81 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 85 aa Download sequence Send to blast |
ADFDLCTDCF NNRKFGSGMS SSDFILMEPG EASGLSGGKW TDQETLLLLE ALELYKENWN 60 EIAEHVATKT KAQCILHFLQ MPIED |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 2yus_A | 2e-11 | 18 | 85 | 1 | 66 | SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:14682613}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of a multiprotein complex equivalent of the SWI/SNF complex, an ATP-dependent chromatin-remodeling complex, which is required for the positive and negative regulation of gene expression of a large number of genes. It changes chromatin structure by altering DNA-histone contacts within a nucleosome, leading eventually to a change in nucleosome position, thus facilitating or repressing binding of gene-specific transcription factors. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012480315.1 | 5e-55 | PREDICTED: SWI/SNF complex subunit SWI3D-like | ||||
| Refseq | XP_016691525.1 | 5e-55 | PREDICTED: SWI/SNF complex subunit SWI3D-like | ||||
| Refseq | XP_016714567.1 | 6e-55 | PREDICTED: SWI/SNF complex subunit SWI3D-like | ||||
| Refseq | XP_016714569.1 | 6e-55 | PREDICTED: SWI/SNF complex subunit SWI3D-like | ||||
| Swissprot | Q8VY05 | 4e-32 | SWI3D_ARATH; SWI/SNF complex subunit SWI3D | ||||
| TrEMBL | A0A0D2RKZ3 | 1e-53 | A0A0D2RKZ3_GOSRA; Uncharacterized protein | ||||
| TrEMBL | A0A1U8JML7 | 1e-53 | A0A1U8JML7_GOSHI; SWI/SNF complex subunit SWI3D-like | ||||
| TrEMBL | A0A1U8LN08 | 1e-53 | A0A1U8LN08_GOSHI; SWI/SNF complex subunit SWI3D-like | ||||
| TrEMBL | A0A2P5QKG5 | 1e-53 | A0A2P5QKG5_GOSBA; Uncharacterized protein | ||||
| STRING | Gorai.005G242600.1 | 2e-54 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM35282 | 2 | 2 |




