PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_Sca100337G01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GRAS
Protein Properties Length: 76aa    MW: 8307.77 Da    PI: 11.9733
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_Sca100337G01genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS85.96.6e-27176120195
             GRAS 120 sqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLr 195
                      ++GlQWpaL+qaLa Rp+gpp lR+Tg+g+p+++ +++l+e+g rLa++A++++v+f f+ ++a+rled+++++L+
  Gh_Sca100337G01   1 MHGLQWPALIQALALRPGGPPLLRLTGIGPPSPDGRDSLREIGLRLAELARSVNVRFAFRGVAASRLEDVKPWMLQ 76 
                      58************************************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098520.168176IPR005202Transcription factor GRAS
PfamPF035142.3E-24176IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MHGLQWPALI QALALRPGGP PLLRLTGIGP PSPDGRDSLR EIGLRLAELA RSVNVRFAFR  60
GVAASRLEDV KPWMLQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.250261e-125boll| ovule| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitously expressed. Expressed in rosette leaves, roots, stems and inflorescences of greenhouse grown. {ECO:0000269|PubMed:11877383, ECO:0000269|PubMed:9237632, ECO:0000269|PubMed:9490740}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Transcription coactivator of the zinc finger transcription factors GAF1/IDD2 and ENY/IDD1 in regulation of gibberellin homeostasis and signaling (PubMed:25035403). No effect of the BOI proteins on its stability. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Positively regulates XERICO expression. In contrast to RGA, it is less sensitive to GA. Its activity is probably regulated by other phytohormones such as auxin and ethylene. {ECO:0000269|PubMed:11487693, ECO:0000269|PubMed:11606551, ECO:0000269|PubMed:11606552, ECO:0000269|PubMed:14973286, ECO:0000269|PubMed:15128937, ECO:0000269|PubMed:16034591, ECO:0000269|PubMed:17933900, ECO:0000269|PubMed:25035403, ECO:0000269|PubMed:9389651}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ2906391e-124GQ290639.1 Gossypium hirsutum cultivar Xinluzao-13 GAI/RGA-like 4-b gene, complete cds.
GenBankHM0347621e-124HM034762.1 Gossypium hirsutum cultivar Xinluzao-13 GAI4b mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001315676.13e-45DELLA protein GAI-like
RefseqXP_009371410.13e-45PREDICTED: DELLA protein GAI-like
RefseqXP_016684439.11e-45PREDICTED: DELLA protein SLR1-like
RefseqXP_016690296.11e-45PREDICTED: DELLA protein SLR1-like
SwissprotQ9LQT81e-26GAI_ARATH; DELLA protein GAI
TrEMBLA0A1U8J8C63e-44A0A1U8J8C6_GOSHI; DELLA protein SLR1-like
TrEMBLA0A1U8JJ303e-44A0A1U8JJ30_GOSHI; DELLA protein SLR1-like
TrEMBLA0A2P5VU032e-44A0A2P5VU03_GOSBA; Uncharacterized protein
STRINGXP_009371410.11e-44(Pyrus x bretschneideri)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.17e-12GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Gallego-Giraldo C, et al.
    Role of the gibberellin receptors GID1 during fruit-set in Arabidopsis.
    Plant J., 2014. 79(6): p. 1020-1032
    [PMID:24961590]
  4. Fukazawa J, et al.
    DELLAs function as coactivators of GAI-ASSOCIATED FACTOR1 in regulation of gibberellin homeostasis and signaling in Arabidopsis.
    Plant Cell, 2014. 26(7): p. 2920-38
    [PMID:25035403]
  5. MarĂ­n-de la Rosa N, et al.
    Genome Wide Binding Site Analysis Reveals Transcriptional Coactivation of Cytokinin-Responsive Genes by DELLA Proteins.
    PLoS Genet., 2015. 11(7): p. e1005337
    [PMID:26134422]
  6. Shi H,Wei Y,Wang Q,Reiter RJ,He C
    Melatonin mediates the stabilization of DELLA proteins to repress the floral transition in Arabidopsis.
    J. Pineal Res., 2016. 60(3): p. 373-9
    [PMID:26887824]
  7. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  8. Qu J,Kang SG,Hah C,Jang JC
    Molecular and cellular characterization of GA-Stimulated Transcripts GASA4 and GASA6 in Arabidopsis thaliana.
    Plant Sci., 2016. 246: p. 1-10
    [PMID:26993231]
  9. Shahnejat-Bushehri S,Nobmann B,Devi Allu A,Balazadeh S
    JUB1 suppresses Pseudomonas syringae-induced defense responses through accumulation of DELLA proteins.
    Plant Signal Behav, 2016. 11(6): p. e1181245
    [PMID:27159137]
  10. Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S
    Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling.
    Nat Plants, 2016. 2: p. 16013
    [PMID:27249348]
  11. Wang H, et al.
    The DELLA-CONSTANS Transcription Factor Cascade Integrates Gibberellic Acid and Photoperiod Signaling to Regulate Flowering.
    Plant Physiol., 2016. 172(1): p. 479-88
    [PMID:27406167]
  12. Li W,Wang H,Yu D
    Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions.
    Mol Plant, 2016. 9(11): p. 1492-1503
    [PMID:27592586]
  13. Liu B,De Storme N,Geelen D
    Gibberellin Induces Diploid Pollen Formation by Interfering with Meiotic Cytokinesis.
    Plant Physiol., 2017. 173(1): p. 338-353
    [PMID:27621423]
  14. Matsuoka K, et al.
    Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls.
    Plant Cell Physiol., 2016. 57(12): p. 2620-2631
    [PMID:27986917]
  15. Zentella R, et al.
    The Arabidopsis O-fucosyltransferase SPINDLY activates nuclear growth repressor DELLA.
    Nat. Chem. Biol., 2017. 13(5): p. 479-485
    [PMID:28244988]
  16. Zhang Y, et al.
    GA-DELLA pathway is involved in regulation of nitrogen deficiency-induced anthocyanin accumulation.
    Plant Cell Rep., 2017. 36(4): p. 557-569
    [PMID:28275852]
  17. Zhang L,Chen L,Yu D
    Transcription Factor WRKY75 Interacts with DELLA Proteins to Affect Flowering.
    Plant Physiol., 2018. 176(1): p. 790-803
    [PMID:29133369]
  18. Nelson SK,Ariizumi T,Steber CM
    Biology in the Dry Seed: Transcriptome Changes Associated with Dry Seed Dormancy and Dormancy Loss in the Arabidopsis GA-Insensitive sleepy1-2 Mutant.
    Front Plant Sci, 2017. 8: p. 2158
    [PMID:29312402]
  19. Liu B,De Storme N,Geelen D
    Cold-Induced Male Meiotic Restitution in Arabidopsis thaliana Is Not Mediated by GA-DELLA Signaling.
    Front Plant Sci, 2018. 9: p. 91
    [PMID:29459879]
  20. Zhang Y, et al.
    DELLA proteins negatively regulate dark-induced senescence and chlorophyll degradation in Arabidopsis through interaction with the transcription factor WRKY6.
    Plant Cell Rep., 2018. 37(7): p. 981-992
    [PMID:29574486]
  21. Felipo-Benavent A, et al.
    Regulation of xylem fiber differentiation by gibberellins through DELLA-KNAT1 interaction.
    Development, 2019.
    [PMID:30389856]
  22. Wright DA, et al.
    Recovery of YAC-end sequences through complementation of an Escherichia coli pyrF mutation.
    Nucleic Acids Res., 1997. 25(13): p. 2679-80
    [PMID:9185581]