![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gh_Sca106972G01 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 96aa MW: 10681.3 Da PI: 8.2215 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 131.5 | 3.4e-41 | 11 | 96 | 1 | 86 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86
+CaaCk+lrrkC +dCv+apyfp e+p+kf nvhk+FGasnv+kl++++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q
Gh_Sca106972G01 11 PCAACKFLRRKCMPDCVFAPYFPPEEPHKFINVHKIFGASNVSKLINEVAPHQREDAVNSLAYEAEARLKDPVYGCVGAISILQRQ 96
7********************************************************************************99987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 25.794 | 10 | 96 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 1.2E-40 | 11 | 96 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
MASSSHSSNF PCAACKFLRR KCMPDCVFAP YFPPEEPHKF INVHKIFGAS NVSKLINEVA 60 PHQREDAVNS LAYEAEARLK DPVYGCVGAI SILQRQ |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 4e-54 | 2 | 96 | 2 | 96 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 4e-54 | 2 | 96 | 2 | 96 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016709390.1 | 3e-65 | PREDICTED: LOB domain-containing protein 25-like | ||||
| Swissprot | Q9FML4 | 2e-58 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
| TrEMBL | A0A1U8L440 | 7e-64 | A0A1U8L440_GOSHI; LOB domain-containing protein 25-like | ||||
| TrEMBL | A0A2P5XGR5 | 7e-64 | A0A2P5XGR5_GOSBA; Uncharacterized protein | ||||
| STRING | Gorai.007G075700.1 | 1e-63 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM131 | 28 | 340 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G63090.4 | 1e-60 | LBD family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




