PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_Sca111532G01

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

NAC

Protein Properties

Length: 97aa MW: 11314.5 Da PI: 4.5342

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_Sca111532G01	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	54.6	3.7e-17	46	93	2	50
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkk 50 +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp k Gh_Sca111532G01 46 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPGK 93 79*************************.89************944 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.44E-17	44	94	IPR003441	NAC domain
PROSITE profile	PS51005	20.029	45	97	IPR003441	NAC domain
Pfam	PF02365	5.6E-8	47	88	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 97 aa Download sequence Send to blast
MAIPPAAIMS NDPNDNTNIN VVDDRNNNNM SSSSNSKDEH EHDMVMPGFR FHPTEEELVE 60 FYLRRKVEGK RFNVELITFL DLYRYDPWEL PGKTTNP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	7e-14	47	91	17	61	Stress-induced transcription factor NAC1
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in aerial organs in early stages of seedling development. {ECO:0000269\|PubMed:17653269}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269\|PubMed:17653269}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269\|PubMed:17653269}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KC847195	1e-149	KC847195.1 Gossypium hirsutum NAC domain protein NAC18 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001314036.1	8e-60	NAC domain-containing protein 72-like
Refseq	XP_012457236.1	8e-60	PREDICTED: NAC domain-containing protein 72
Refseq	XP_016678255.1	8e-60	PREDICTED: NAC domain-containing protein 72-like
Refseq	XP_017644131.1	8e-60	PREDICTED: NAC domain-containing protein 35-like
Swissprot	Q9ZVP8	2e-28	NAC35_ARATH; NAC domain-containing protein 35
TrEMBL	A0A0D2RJ65	2e-58	A0A0D2RJ65_GOSRA; Uncharacterized protein
TrEMBL	A0A0D2T4V9	2e-58	A0A0D2T4V9_GOSRA; Uncharacterized protein
TrEMBL	A0A1U8IJI2	2e-58	A0A1U8IJI2_GOSHI; NAC domain-containing protein 72-like
TrEMBL	A0A1U8KCX9	2e-58	A0A1U8KCX9_GOSHI; NAC domain-containing protein 72-like
TrEMBL	W6JAN0	2e-58	W6JAN0_GOSHI; NAC domain protein NAC18
STRING	Gorai.011G090000.1	4e-59	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7967	13	40

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G02450.1	1e-29	NAC domain containing protein 35

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Okajima K Molecular mechanism of phototropin light signaling. J. Plant Res., 2016. 129(2): p. 149-57 [PMID:26815763] Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii. J Phys Chem B, 2018. 122(6): p. 1801-1815 [PMID:29355019]