![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gh_Sca118136G01 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 90aa MW: 9922.43 Da PI: 7.7735 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 127.7 | 5.4e-40 | 10 | 89 | 1 | 80 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvi 80
+CaaCk lrrkC +dC++apyfp e+p+kf nvhk+FGasnv+kll+++p+++reda++sl+yeAear++dPvyG+vg i
Gh_Sca118136G01 10 PCAACKCLRRKCMPDCIFAPYFPPEEPQKFINVHKIFGASNVSKLLNDVPPHQREDAVNSLAYEAEARMKDPVYGCVGAI 89
7*****************************************************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 25.643 | 9 | 90 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 2.2E-39 | 10 | 89 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 90 aa Download sequence Send to blast |
MASSSYSNPP CAACKCLRRK CMPDCIFAPY FPPEEPQKFI NVHKIFGASN VSKLLNDVPP 60 HQREDAVNSL AYEAEARMKD PVYGCVGAIS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 8e-50 | 3 | 90 | 4 | 91 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 8e-50 | 3 | 90 | 4 | 91 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012458035.1 | 2e-61 | PREDICTED: LOB domain-containing protein 25-like | ||||
| Refseq | XP_012458036.1 | 2e-61 | PREDICTED: LOB domain-containing protein 25-like | ||||
| Refseq | XP_012458037.1 | 2e-61 | PREDICTED: LOB domain-containing protein 25-like | ||||
| Refseq | XP_016679016.1 | 2e-61 | PREDICTED: LOB domain-containing protein 25-like | ||||
| Refseq | XP_016679017.1 | 2e-61 | PREDICTED: LOB domain-containing protein 25-like | ||||
| Refseq | XP_017614825.1 | 2e-61 | PREDICTED: LOB domain-containing protein 25-like | ||||
| Refseq | XP_017614826.1 | 2e-61 | PREDICTED: LOB domain-containing protein 25-like | ||||
| Swissprot | Q8L8Q3 | 2e-50 | LBD25_ARATH; LOB domain-containing protein 25 | ||||
| Swissprot | Q9FML4 | 2e-50 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
| TrEMBL | A0A0D2RYJ3 | 4e-60 | A0A0D2RYJ3_GOSRA; Uncharacterized protein | ||||
| TrEMBL | A0A1U8ILK5 | 4e-60 | A0A1U8ILK5_GOSHI; LOB domain-containing protein 25-like | ||||
| TrEMBL | A0A2P5XNB6 | 4e-60 | A0A2P5XNB6_GOSBA; Uncharacterized protein | ||||
| STRING | Gorai.012G063800.1 | 7e-61 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM131 | 28 | 340 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G27650.1 | 7e-53 | LOB domain-containing protein 25 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




