 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Gh_Sca121194G01 |
| Common Name | NAP, SNAC1 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
| Family |
NAC |
| Protein Properties |
Length: 58aa MW: 6591.66 Da PI: 10.7463 |
| Description |
NAC family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Gh_Sca121194G01 | genome | NAU-NBI | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | NAM | 52.9 | 1.3e-16 | 1 | 43 | 85 | 128 |
NAM 85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
atg+dk+++s +++ vg+kk Lvfykg+ pkg ktdW+mheyrl
Gh_Sca121194G01 1 ATGTDKAIYS-GSKYVGVKKALVFYKGKPPKGLKTDWIMHEYRL 43
69********.999****************************98 PP
|
| 3D Structure ? help Back to Top |
 |
| PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
| 1ut4_A | 7e-15 | 1 | 58 | 100 | 153 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 7e-15 | 1 | 58 | 100 | 153 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 7e-15 | 1 | 58 | 100 | 153 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 7e-15 | 1 | 58 | 100 | 153 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 8e-15 | 1 | 58 | 103 | 156 | NAC domain-containing protein 19 |
| 3swm_B | 8e-15 | 1 | 58 | 103 | 156 | NAC domain-containing protein 19 |
| 3swm_C | 8e-15 | 1 | 58 | 103 | 156 | NAC domain-containing protein 19 |
| 3swm_D | 8e-15 | 1 | 58 | 103 | 156 | NAC domain-containing protein 19 |
| 3swp_A | 8e-15 | 1 | 58 | 103 | 156 | NAC domain-containing protein 19 |
| 3swp_B | 8e-15 | 1 | 58 | 103 | 156 | NAC domain-containing protein 19 |
| 3swp_C | 8e-15 | 1 | 58 | 103 | 156 | NAC domain-containing protein 19 |
| 3swp_D | 8e-15 | 1 | 58 | 103 | 156 | NAC domain-containing protein 19 |
| 4dul_A | 7e-15 | 1 | 58 | 100 | 153 | NAC domain-containing protein 19 |
| 4dul_B | 7e-15 | 1 | 58 | 100 | 153 | NAC domain-containing protein 19 |
| Search in ModeBase |
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | TISSUE SPECIFICITY: Expressed in roots, stem, flowers, and leaves. {ECO:0000269|PubMed:29760199}. |
| Uniprot | TISSUE SPECIFICITY: Expressed in roots, stem, flowers, and leaves. {ECO:0000269|PubMed:29760199}. |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence and reduces fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. {ECO:0000269|PubMed:29760199}. |
| UniProt | Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269|PubMed:29760199}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. {ECO:0000269|PubMed:29760199}. |
| UniProt | INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269|PubMed:29760199}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | JQ914140 | 1e-87 | JQ914140.1 Gossypium hirsutum NAC domain protein 9 (NAC9) mRNA, complete cds. |
| GenBank | KP203895 | 1e-87 | KP203895.1 Gossypium hirsutum putative NAC transcription factor (SNAC1) mRNA, complete cds. |
| GenBank | KP300008 | 1e-87 | KP300008.1 Gossypium hirsutum cultivar CCRI10 NAP (NAP) mRNA, complete cds. |