![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gh_Sca129122G01 | ||||||||
| Common Name | SPL17 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 85aa MW: 9282.42 Da PI: 9.0717 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 75.8 | 6.8e-24 | 38 | 85 | 1 | 48 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48
+Cqve+C adl++ak+yhrrhkvCe+hska+++lv +++qrfCqqCsr
Gh_Sca129122G01 38 VCQVEDCGADLTNAKDYHRRHKVCEMHSKASKALVGNVMQRFCQQCSR 85
6**********************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.1100.10 | 5.0E-25 | 31 | 85 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 19.991 | 36 | 85 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 2.22E-22 | 37 | 85 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 2.3E-17 | 39 | 85 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 85 aa Download sequence Send to blast |
LGGQGDHGYP ISQGEMKNWE GTSGKKTKLN GGSGNRAVCQ VEDCGADLTN AKDYHRRHKV 60 CEMHSKASKA LVGNVMQRFC QQCSR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj0_A | 1e-23 | 34 | 85 | 1 | 52 | squamosa promoter-binding protein-like 12 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed during plant development. {ECO:0000269|PubMed:10524240}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000269|PubMed:16554053}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KJ622325 | 1e-141 | KJ622325.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL17) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017630761.1 | 1e-53 | PREDICTED: squamosa promoter-binding-like protein 1 | ||||
| Swissprot | Q9S7P5 | 8e-28 | SPL12_ARATH; Squamosa promoter-binding-like protein 12 | ||||
| TrEMBL | A0A0B0MYY2 | 2e-52 | A0A0B0MYY2_GOSAR; Squamosa promoter-binding-like protein 1 | ||||
| TrEMBL | A0A2P5XYX4 | 3e-52 | A0A2P5XYX4_GOSBA; Uncharacterized protein | ||||
| STRING | Gorai.007G116100.1 | 7e-53 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM868 | 28 | 118 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G60030.1 | 3e-30 | squamosa promoter-binding protein-like 12 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




