PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_Sca130119G01

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

NF-YB

Protein Properties

Length: 86aa MW: 9757.61 Da PI: 5.7315

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_Sca130119G01	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	71.2	1.8e-22	1	48	50	97
NF-YB 50 asdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 asdkc++e+rkt+ngdd++wal+ lGf++y++++ yl+kyre+e++k Gh_Sca130119G01 1 ASDKCRKENRKTVNGDDICWALGALGFDNYADAIVRYLHKYREVERDK 48 89********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	5.7E-21	1	79	IPR009072	Histone-fold
SuperFamily	SSF47113	9.38E-17	1	73	IPR009072	Histone-fold
PRINTS	PR00615	1.2E-6	5	23	No hit	No description
PRINTS	PR00615	1.2E-6	24	42	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 86 aa Download sequence Send to blast
ASDKCRKENR KTVNGDDICW ALGALGFDNY ADAIVRYLHK YREVERDKAT QNKATCISSQ 60 DKDEESSEDR SNQPPHQQAE APSTRV

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in flowers, siliques and young rosettes. {ECO:0000269\|PubMed:11250072}.

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AJ567167	4e-61	AJ567167.1 Gossypium hirsutum microsatellite DNA mGhCIR221, clone CIR221.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016670149.1	4e-59	PREDICTED: nuclear transcription factor Y subunit B-4-like
Swissprot	O04027	8e-24	NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBL	A0A1U8I387	9e-58	A0A1U8I387_GOSHI; nuclear transcription factor Y subunit B-4-like
STRING	Gorai.013G205200.1	2e-58	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM255	28	229

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09030.1	2e-24	nuclear factor Y, subunit B4

Publications ? help Back to Top
Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]