PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_Sca135309G01
Organism
Gossypium hirsutum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family HSF
Protein Properties Length: 70aa    MW: 8086.3 Da    PI: 9.6984
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_Sca135309G01genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind78.61e-241270260
                     HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
     HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
                     F+ k+y++++d+ ++++i+w + +nsf+v+d+  f++++Lp yFkhsnf+SFvRQLn+Y
  Gh_Sca135309G01 12 FVVKTYQMVNDPMTNTVITWGKANNSFIVIDHLVFTQRILPVYFKHSNFSSFVRQLNTY 70
                     9*********************************************************9 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.102.2E-24670IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004158.2E-11870IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467852.31E-21970IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004471.1E-191270IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000569.2E-151235IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000569.2E-155062IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000569.2E-156370IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 70 aa     Download sequence    Send to blast
MEGNSTNIVA PFVVKTYQMV NDPMTNTVIT WGKANNSFIV IDHLVFTQRI LPVYFKHSNF  60
SSFVRQLNTY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5w_B1e-171070262Putative transcription factor
5d5x_B1e-171070262Putative transcription factor
5d5x_E1e-171070262Putative transcription factor
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.133556e-57boll| ovule| stem
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR0674081e-111KR067408.1 Gossypium hirsutum HSF27 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017609786.14e-43PREDICTED: heat stress transcription factor C-1
SwissprotQ9LV522e-29HSFC1_ARATH; Heat stress transcription factor C-1
TrEMBLA0A2P5X1B42e-42A0A2P5X1B4_GOSBA; Uncharacterized protein
STRINGGorai.009G024700.17e-42(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96528111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24520.19e-32heat shock transcription factor C1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Guan Q,Yue X,Zeng H,Zhu J
    The protein phosphatase RCF2 and its interacting partner NAC019 are critical for heat stress-responsive gene regulation and thermotolerance in Arabidopsis.
    Plant Cell, 2014. 26(1): p. 438-53
    [PMID:24415771]