![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gh_Sca138215G01 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 103aa MW: 11462 Da PI: 8.2151 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 76.5 | 4.9e-24 | 1 | 64 | 36 | 99 |
DUF260 36 lFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99
+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++el+++++
Gh_Sca138215G01 1 IFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAITFLQRQVQRLQKELDAANA 64
7**********************************************************99876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 15.69 | 1 | 66 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 6.0E-22 | 1 | 63 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 103 aa Download sequence Send to blast |
IFGASNVTKL LNELLPHQRE DAVNSLAYEA EARVRDPVYG CVGAITFLQR QVQRLQKELD 60 AANADLIRYA CNDIPTGLPQ VTGTSSVQPP LTPRNRLAEF NRR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 3e-42 | 1 | 82 | 46 | 130 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 3e-42 | 1 | 82 | 46 | 130 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016748663.1 | 1e-69 | PREDICTED: protein LATERAL ORGAN BOUNDARIES-like | ||||
| Refseq | XP_016748664.1 | 1e-69 | PREDICTED: protein LATERAL ORGAN BOUNDARIES-like | ||||
| Refseq | XP_017605768.1 | 2e-69 | PREDICTED: protein LATERAL ORGAN BOUNDARIES-like | ||||
| Swissprot | Q9FML4 | 1e-41 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
| TrEMBL | A0A1U8PEF1 | 3e-68 | A0A1U8PEF1_GOSHI; protein LATERAL ORGAN BOUNDARIES-like | ||||
| TrEMBL | A0A2P5WNI8 | 4e-68 | A0A2P5WNI8_GOSBA; Uncharacterized protein | ||||
| STRING | EOY20851 | 7e-59 | (Theobroma cacao) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM131 | 28 | 340 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G63090.4 | 6e-44 | LBD family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




