![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gh_Sca140422G01 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 78aa MW: 9297.65 Da PI: 11.2548 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 105.8 | 5.6e-33 | 2 | 72 | 57 | 128 |
NAM 57 ewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
ewyf+s+rdkky++g+r+nrat+ gyWkatgkd++v s ++++vg+kktLv+y+grap+g +t+Wvmheyrl
Gh_Sca140422G01 2 EWYFYSPRDKKYPNGSRTNRATRGGYWKATGKDRTVQS-QKRAVGIKKTLVYYRGRAPHGIRTNWVMHEYRL 72
8************************************9.9999***************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 36.017 | 1 | 78 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 4.71E-34 | 2 | 75 | IPR003441 | NAC domain |
| Pfam | PF02365 | 3.8E-16 | 3 | 72 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 78 aa Download sequence Send to blast |
MEWYFYSPRD KKYPNGSRTN RATRGGYWKA TGKDRTVQSQ KRAVGIKKTL VYYRGRAPHG 60 IRTNWVMHEY RLLNSTLK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 8e-32 | 2 | 76 | 72 | 146 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 8e-32 | 2 | 76 | 72 | 146 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 8e-32 | 2 | 76 | 72 | 146 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 8e-32 | 2 | 76 | 72 | 146 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 9e-32 | 2 | 76 | 75 | 149 | NAC domain-containing protein 19 |
| 3swm_B | 9e-32 | 2 | 76 | 75 | 149 | NAC domain-containing protein 19 |
| 3swm_C | 9e-32 | 2 | 76 | 75 | 149 | NAC domain-containing protein 19 |
| 3swm_D | 9e-32 | 2 | 76 | 75 | 149 | NAC domain-containing protein 19 |
| 3swp_A | 9e-32 | 2 | 76 | 75 | 149 | NAC domain-containing protein 19 |
| 3swp_B | 9e-32 | 2 | 76 | 75 | 149 | NAC domain-containing protein 19 |
| 3swp_C | 9e-32 | 2 | 76 | 75 | 149 | NAC domain-containing protein 19 |
| 3swp_D | 9e-32 | 2 | 76 | 75 | 149 | NAC domain-containing protein 19 |
| 4dul_A | 8e-32 | 2 | 76 | 72 | 146 | NAC domain-containing protein 19 |
| 4dul_B | 8e-32 | 2 | 76 | 72 | 146 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in a few sieve element cells before enucleation and in phloem-pole pericycle cells. {ECO:0000269|PubMed:25081480}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in a few sieve element cells before enucleation and in phloem-pole pericycle cells. {ECO:0000269|PubMed:25081480}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. | |||||
| UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016692076.1 | 2e-51 | PREDICTED: NAC domain-containing protein 86-like | ||||
| Refseq | XP_016714972.1 | 2e-51 | PREDICTED: NAC domain-containing protein 86-like | ||||
| Swissprot | A4VCM0 | 3e-39 | NAC45_ARATH; NAC domain-containing protein 45 | ||||
| Swissprot | Q9FFI5 | 3e-39 | NAC86_ARATH; NAC domain-containing protein 86 | ||||
| TrEMBL | A0A1U8JP71 | 5e-50 | A0A1U8JP71_GOSHI; NAC domain-containing protein 86-like | ||||
| TrEMBL | A0A1U8LK66 | 4e-50 | A0A1U8LK66_GOSHI; NAC domain-containing protein 86-like | ||||
| STRING | Gorai.004G268400.1 | 3e-50 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM21958 | 4 | 5 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G17260.1 | 1e-41 | NAC domain containing protein 86 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




