PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_Sca145821G01

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

NF-YC

Protein Properties

Length: 63aa MW: 7294.48 Da PI: 5.0201

Description

NF-YC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_Sca145821G01	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YC	116.8	1e-36	1	63	30	92
NF-YC 30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdfl 92 +kadedv+misaeaP+l++kacelfilelt+rswlhaeenkrrtl+k+diaaa+trtdifdfl Gh_Sca145821G01 1 MKADEDVRMISAEAPILFAKACELFILELTIRSWLHAEENKRRTLQKNDIAAAITRTDIFDFL 63 9*************************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF47113	1.65E-22	1	63	IPR009072	Histone-fold
Pfam	PF00808	5.5E-15	1	54	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
Gene3D	G3DSA:1.10.20.10	1.6E-27	1	63	IPR009072	Histone-fold

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 63 aa Download sequence Send to blast
MKADEDVRMI SAEAPILFAK ACELFILELT IRSWLHAEEN KRRTLQKNDI AAAITRTDIF 60 DFL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5g49_B	3e-36	1	63	27	89	NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3
Search in ModeBase

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	41	47	RRTLQKN

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Ghi.9838	1e-104	boll\| ovule

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Ubiquitous. Present in etiolated seedlings. {ECO:0000269\|PubMed:11250072, ECO:0000269\|PubMed:17322342}.
Uniprot	TISSUE SPECIFICITY: Ubiquitous. Present in etiolated seedlings. {ECO:0000269\|PubMed:11250072, ECO:0000269\|PubMed:17322342, ECO:0000269\|PubMed:9662544}.

Functional Description ? help Back to Top
Source	Description
UniProt	Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000250, ECO:0000269\|PubMed:17322342}.
UniProt	Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002284041.1	1e-39	PREDICTED: nuclear transcription factor Y subunit C-1 isoform X1
Refseq	XP_003602805.1	2e-39	nuclear transcription factor Y subunit C-1 isoform X2
Refseq	XP_004138046.1	2e-39	PREDICTED: nuclear transcription factor Y subunit C-1-like
Refseq	XP_008464428.1	2e-39	PREDICTED: nuclear transcription factor Y subunit C-1
Refseq	XP_009149806.1	2e-39	PREDICTED: nuclear transcription factor Y subunit C-1
Refseq	XP_010026475.1	1e-39	PREDICTED: nuclear transcription factor Y subunit C-1
Refseq	XP_010250693.1	1e-39	PREDICTED: nuclear transcription factor Y subunit C-1-like isoform X2
Refseq	XP_010663766.1	1e-39	PREDICTED: nuclear transcription factor Y subunit C-1 isoform X2
Refseq	XP_013461673.1	2e-39	nuclear transcription factor Y subunit C-1 isoform X1
Refseq	XP_013727066.1	2e-39	nuclear transcription factor Y subunit C-1
Refseq	XP_016169923.2	2e-39	LOW QUALITY PROTEIN: nuclear transcription factor Y subunit C-1
Refseq	XP_022039073.1	2e-39	nuclear transcription factor Y subunit C-1-like isoform X1
Refseq	XP_022039075.1	1e-39	nuclear transcription factor Y subunit C-1-like isoform X2
Refseq	XP_022134838.1	2e-39	nuclear transcription factor Y subunit C-1-like
Refseq	XP_022885495.1	2e-39	nuclear transcription factor Y subunit C-1
Refseq	XP_022921750.1	2e-39	nuclear transcription factor Y subunit C-1-like
Refseq	XP_022987443.1	2e-39	nuclear transcription factor Y subunit C-1
Refseq	XP_023516854.1	2e-39	nuclear transcription factor Y subunit C-1
Refseq	XP_028765104.1	2e-39	nuclear transcription factor Y subunit C-1-like isoform X2
Refseq	XP_028766187.1	2e-39	nuclear transcription factor Y subunit C-1-like
Swissprot	Q9FMV5	3e-40	NFYC4_ARATH; Nuclear transcription factor Y subunit C-4
Swissprot	Q9SMP0	2e-40	NFYC1_ARATH; Nuclear transcription factor Y subunit C-1
TrEMBL	A0A1U7ZPU6	3e-38	A0A1U7ZPU6_NELNU; nuclear transcription factor Y subunit C-1-like isoform X2
TrEMBL	A0A251US04	3e-38	A0A251US04_HELAN; Putative histone-fold protein
TrEMBL	A0A2U1M706	2e-38	A0A2U1M706_ARTAN; Nuclear transcription factor Y subunit C-1
TrEMBL	A0A438EY75	3e-38	A0A438EY75_VITVI; Nuclear transcription factor Y subunit C-1
TrEMBL	A0A4D9AFA2	2e-38	A0A4D9AFA2_SALSN; Uncharacterized protein
STRING	XP_006493208.1	8e-39	(Citrus sinensis)
STRING	evm.model.supercontig_13.107	2e-39	(Carica papaya)
STRING	XP_008464428.1	6e-39	(Cucumis melo)
STRING	XP_004138046.1	6e-39	(Cucumis sativus)
STRING	Bra018046.1-P	6e-39	(Brassica rapa)
STRING	GLYMA06G17780.1	8e-39	(Glycine max)
STRING	AES73056	6e-39	(Medicago truncatula)
STRING	XP_007137908.1	7e-39	(Phaseolus vulgaris)
STRING	cassava4.1_015422m	8e-39	(Manihot esculenta)
STRING	cassava4.1_034343m	8e-39	(Manihot esculenta)
STRING	Solyc03g110860.2.1	8e-39	(Solanum lycopersicum)
STRING	XP_009779358.1	8e-39	(Nicotiana sylvestris)
STRING	XP_009618952.1	8e-39	(Nicotiana tomentosiformis)
STRING	XP_009619035.1	8e-39	(Nicotiana tomentosiformis)
STRING	PGSC0003DMT400039470	8e-39	(Solanum tuberosum)
STRING	Migut.I00537.1.p	8e-39	(Erythranthe guttata)
STRING	XP_008798937.1	7e-39	(Phoenix dactylifera)
STRING	A0A087GWB6	8e-39	(Arabis alpina)
STRING	XP_010026475.1	5e-39	(Eucalyptus grandis)
STRING	XP_006436849.1	8e-39	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM478	28	160

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G48590.1	9e-43	nuclear factor Y, subunit C1

Publications ? help Back to Top
Shi H,Chan ZL AtHAP5A modulates freezing stress resistance in Arabidopsis independent of the CBF pathway. Plant Signal Behav, 2015. [PMID:24831307] Shi H,Chan ZL AtHAP5A modulates freezing stress resistance in Arabidopsis independent of the CBF pathway. Plant Signal Behav, 2014. 9(7): p. e29109 [PMID:25763489] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Liu X, et al. The NF-YC-RGL2 module integrates GA and ABA signalling to regulate seed germination in Arabidopsis. Nat Commun, 2016. 7: p. 12768 [PMID:27624486] Myers ZA, et al. NUCLEAR FACTOR Y, Subunit C (NF-YC) Transcription Factors Are Positive Regulators of Photomorphogenesis in Arabidopsis thaliana. PLoS Genet., 2016. 12(9): p. e1006333 [PMID:27685091] Tang Y, et al. Arabidopsis NF-YCs Mediate the Light-Controlled Hypocotyl Elongation via Modulating Histone Acetylation. Mol Plant, 2017. 10(2): p. 260-273 [PMID:27876642] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722] Qi M, et al. QQS orphan gene and its interactor NF-YC4 reduce susceptibility to pathogens and pests. Plant Biotechnol. J., 2019. 17(1): p. 252-263 [PMID:29878511]