![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gh_Sca156698G01 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 70aa MW: 8124.1 Da PI: 5.11 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 110.1 | 1.3e-34 | 1 | 64 | 35 | 98 |
NF-YB 35 vqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegekk 98
+qecvsefisfvtseasdkc++e+rkting+d++wal tlGf+dy++pl+ yl+kyre+eg++k
Gh_Sca156698G01 1 MQECVSEFISFVTSEASDKCRKERRKTINGEDICWALVTLGFDDYAAPLRRYLNKYREVEGDNK 64
79***********************************************************975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 8.87E-25 | 1 | 67 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 6.3E-19 | 1 | 19 | No hit | No description |
| Gene3D | G3DSA:1.10.20.10 | 2.2E-31 | 1 | 68 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 6.7E-14 | 1 | 37 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PROSITE pattern | PS00685 | 0 | 4 | 20 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 6.3E-19 | 20 | 38 | No hit | No description |
| PRINTS | PR00615 | 6.3E-19 | 39 | 57 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 70 aa Download sequence Send to blast |
MQECVSEFIS FVTSEASDKC RKERRKTING EDICWALVTL GFDDYAAPLR RYLNKYREVE 60 GDNKAANQDK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_B | 5e-26 | 1 | 58 | 37 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 5e-26 | 1 | 58 | 37 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in the whole plant, except roots. {ECO:0000269|PubMed:11867211}. | |||||
| Uniprot | TISSUE SPECIFICITY: Ubiquitous. Predominantly expressed in leaves, flowers and siliques. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:9662544}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JX579563 | 1e-41 | JX579563.1 Gossypium hirsutum clone NBRI_GE11831 microsatellite sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012453013.1 | 2e-45 | PREDICTED: nuclear transcription factor Y subunit B-1-like | ||||
| Refseq | XP_016700599.1 | 2e-45 | PREDICTED: nuclear transcription factor Y subunit B-1-like | ||||
| Swissprot | Q67XJ2 | 1e-31 | NFYBA_ARATH; Nuclear transcription factor Y subunit B-10 | ||||
| Swissprot | Q9SLG0 | 6e-32 | NFYB1_ARATH; Nuclear transcription factor Y subunit B-1 | ||||
| TrEMBL | A0A2P5RSV4 | 7e-45 | A0A2P5RSV4_GOSBA; Uncharacterized protein | ||||
| STRING | EOY06479 | 2e-39 | (Theobroma cacao) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM255 | 28 | 229 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38880.3 | 2e-34 | nuclear factor Y, subunit B1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




